Property Summary

NCBI Gene PubMed Count 40
PubMed Score 49.60
PubTator Score 63.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non-inflammatory breast cancer -2.100 6.8e-12
psoriasis -1.400 3.6e-03
subependymal giant cell astrocytoma -1.030 3.8e-02

Gene RIF (40)

AA Sequence

MTGRDSLSDGRTSSRALVPGGSPRGSRPRGFAITDLLGLEAELPAPAGPGQGSGCEGPAVAPCPGPGLDG      1 - 70
SSLARGALPLGLGLLCGFGTQPPAAARAPCLLLADVPFLPPRGPEPAAPLAPSRPPPALGRQKRSDSVST     71 - 140
SDEDSQSEDRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQV    141 - 210
WFQNRRAKWRKREKRWGGSSVMAEYGLYGAMVRHCIPLPDSVLNSAEGGLLGSCAPWLLGMHKKSMGMIR    211 - 280
KPGSEDKLAGLWGSDHFKEGSSQSESGSQRGSDKVSPENGLEDVAIDLSSSARQETKKVHPGAGAQGGSN    281 - 350
STALEGPQPGKVGAT                                                           351 - 365
//

Text Mined References (40)

PMID Year Title