Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.14
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.400 2.3e-05
astrocytic glioma -1.100 2.4e-02
Astrocytoma, Pilocytic -2.400 1.8e-09
atypical teratoid/rhabdoid tumor -1.500 5.6e-03
ependymoma -1.200 1.8e-02
glioblastoma -2.500 1.0e-09
group 3 medulloblastoma -1.700 5.4e-03
lung adenocarcinoma 1.400 4.2e-03
medulloblastoma, large-cell -2.100 2.0e-03
oligodendroglioma -1.900 7.6e-21
osteosarcoma 1.083 2.7e-04
pituitary cancer 1.400 5.7e-06
psoriasis -1.300 3.5e-22

Synonym

Accession Q96N03 E1P5V7 Q5JWZ4 Q5JWZ5 Q8ND45 Q9BR37
Symbols C20orf102
dJ1118M15.2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGAPLAVALGALHYLALFLQLGGATRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSP      1 - 70
SYSLEIQWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTY     71 - 140
ECRVIDFSDGKARHHKVKAYLRVQPGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQEACSL          141 - 204
//

Text Mined References (8)

PMID Year Title