Property Summary

NCBI Gene PubMed Count 46
PubMed Score 71.11
PubTator Score 70.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
astrocytoma -5.600 1.8e-03
posterior fossa group A ependymoma -5.900 5.9e-16
oligodendroglioma -4.500 5.5e-16
esophageal adenocarcinoma -2.200 2.0e-02
psoriasis 2.500 3.2e-04
glioblastoma -5.800 6.4e-06
osteosarcoma 1.809 9.8e-03
medulloblastoma -5.800 2.0e-07
atypical teratoid / rhabdoid tumor -7.100 7.1e-14
medulloblastoma, large-cell -6.200 6.2e-07
primitive neuroectodermal tumor -4.400 8.5e-05
Atopic dermatitis 1.400 3.4e-03
adrenocortical carcinoma -1.759 2.5e-02
non-small cell lung cancer 2.467 1.1e-09
Hydrolethalus syndrome -2.221 2.3e-02
colon cancer 3.400 2.1e-03
lung cancer 4.000 1.7e-06
active Crohn's disease 1.745 2.2e-03
Parkinson's disease -2.200 3.5e-02
interstitial cystitis -1.700 1.7e-04
cystic fibrosis 2.000 1.6e-03
adult high grade glioma -6.000 9.9e-07
pilocytic astrocytoma -6.100 3.7e-12
subependymal giant cell astrocytoma -4.522 4.3e-03
severe Alzheimer's disease -1.576 3.5e-02
Breast cancer -1.900 4.3e-08
lung carcinoma -2.000 6.6e-14
Pick disease -3.400 6.9e-03
ulcerative colitis 2.000 3.8e-05
ovarian cancer 1.100 1.9e-02

Synonym

Accession P62760 D6W515 P28677 P29103 P42323 Q9UM20 VILIP
Symbols HLP3
VILIP
HPCAL3
HUVISL1
VILIP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (35)

PMID Text
26836160 These data indicate that VILIP-1 alone or in combination with other AD CSF biomarkers represent a valuable marker for the early diagnosis of AD, recognition of MCI patients at higher risk to develop dementia, and in differentiating AD from LBD.
26769253 These findings suggest a unique role for cerebrospinal fluid Vilip-1 as a biomarker of entorhinal cortex neuron loss in Alzheimer disease
26683098 Underexpression of VSNL1 is associated with glioblastoma multiforme.
25019684 Results show that in the presence of calcium, N-myristoylation significantly increases the kinetic rate of VILIP adsorption to the membrane.
24742816 We show for the first time that the C-terminus of VILIP-1, containing Cys187, might represent a novel redox-sensitive motif and that VILIP-1 dimerization and aggregation are hallmarks of amyotrophic lateral sclerosis
24075506 The results suggest that both serum and cerebrospinal fluid levels of VILIP-1 may be one of predictive markers of acute encephalopathy with biphasic seizures.
23800322 The results showed that the CSF VILIP-1 level had significantly increased in Alzheimer disease patients compared with both normal controls and Lewy body dementia patients.
22832524 VSNL1 single-nucleotide polymorphisms and pathological changes in VILIP-1 protein expression, possibly occurring during brain development, may contribute to the morphological and functional deficits observed in schizophrenia.
22357717 The findings suggest that CSF VILIP-1 and VILIP-1/Abeta42 predict rates of global cognitive decline similarly to tau and tau/Abeta42, and may be useful CSF surrogates for neurodegeneration in early Alzheimer disease.
22331379 VSNL1 may play a role in the pathophysiology of aldosterone-producing adenomas harboring mutations in the potassium channel KCNJ5 via its antiapoptotic function in response to calcium cytotoxicity and its effect on aldosterone production.
22052372 Patients with high VSNL-1 expression had significantly poorer prognosis than those with low expression in stage III disease
22005930 SNPs upstream of SLC2A9 and within VSNL1 showed strongest evidence for association with AD + P when compared with controls.
21823155 Data suggest that CSF VILIP-1 and VILIP-1/Abeta42 offer diagnostic utility for early AD, and can predict future cognitive impairment in cognitively normal individuals similarly to tau and tau/Abeta42, respectively.
21169352 VILIP-1 forms a dimer in solution independent of Ca(2+) and myristoylation. The dimerization site is composed of residues in EF4 and the loop region between EF3 and EF4, confirmed by mutagenesis.
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20079378 Results show that VILIP-1 regulates the cell surface localization of natriuretic peptide receptor B.
19674972 Deletion and site-directed mutagenesis combined with in silico transcription factor binding analysis of VSNL1 promoter identified nuclear respiratory factor (NRF)-1/alpha-PAL as a major player in regulating VSNL1 minimal promoter activity.
19065602 Data may imply the functional contribution of disulfide dimer to the interaction of VILIP-1 with its physiological target(s).
19063970 Results report that overexpression of VILIP-1 enhances ACh responsiveness, whereas siRNA against VILIP-1 reduces alpha4beta2 nAChR currents of hippocampal neurons.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18922787 VILIP1 constitutively binds to P2X2 receptors and displays enhanced interactions in an activation- and calcium-dependent manner owing to exposure of its binding segment in P2X2 receptors
18691652 VILIP-1 and its interaction partner nicotinic receptor alpha4beta2 co-localize in morphologically identified human hippocampal interneurons, the number of which is pathologically up-regulated in schizophrenic brains.
18301774 VILIP-1 expression is silenced by promoter hypermethylation and histone deacetylation in aggressive NSCLC cell lines and primary tumors
17615261 Distinct roles of proliferative and invasive phenotypes contributing to neuroblastoma progression which demonstrates that VSNL-1 is important in neuroblastoma metastasis.
16731532 VILIP-1 is expressed in pancreatic beta-cells. Increased VILIP-1 enhanced insulin secretion in a cAMP-associated manner. Down-regulation of VILIP-1 was accompanied by decreased cAMP accumulation but increased insulin gene transcription
16703469 The interaction of human VILIP1 and VILIP3 with divalent cations was explored using circular dichroism and fluorescence measurement.
12681369 VILIP-1 expression is associated with group I mGlu receptor-mediated plasticity in the dentate gyrus in vivo
12202488 VILIP-1 modulates the surface expression and agonist sensitivity of the alpha 4beta 2 nicotinic acetylcholine receptor
12200122 EF-hand motifs in visinin-like protein 1
12196554 reversibility and stimulus-dependent occurrence of a calcium-myristoyl switch of VILIP-1 in living neurons, enabling them to activate specific targets localized in distinct membrane compartments
11930147 A shift in the cellular expression of visinin-like protein 1 has been found in the hipppocampi of schizophrenics, since fewer pyramidal neurons but more interneurons show immunoreactivity.
11592857 VILIP-1 is associated with amyloid plaques and extracellular tangles in Alzheimer disease and promotes cell death and tau phosphorylation in vitro
11579136 VILIP-1 modulates cGMP-accumulation in transfected neural cells and cerebellar granule neurons
9109541 VILIP-1 modulates cAMP-accumulation in C6 glioma cells
8780737 VILIP-1 interacts with cell membrane and actin-based cytoskeleton

AA Sequence

MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM     71 - 140
NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK                       141 - 191
//

Text Mined References (48)

PMID Year Title
26836160 2016 Predictive Value of Cerebrospinal Fluid Visinin-Like Protein-1 Levels for Alzheimer's Disease Early Detection and Differential Diagnosis in Patients with Mild Cognitive Impairment.
26769253 2016 Altered Levels of Visinin-Like Protein 1 Correspond to Regional Neuronal Loss in Alzheimer Disease and Frontotemporal Lobar Degeneration.
26683098 2016 Dysregulated miR-671-5p / CDR1-AS / CDR1 / VSNL1 axis is involved in glioblastoma multiforme.
25416956 2014 A proteome-scale map of the human interactome network.
25019684 2014 Specific interaction to PIP2 increases the kinetic rate of membrane binding of VILIPs, a subfamily of Neuronal Calcium Sensors (NCS) proteins.
24742816 2014 Dimerization of visinin-like protein 1 is regulated by oxidative stress and calcium and is a pathological hallmark of amyotrophic lateral sclerosis.
24075506 2014 Serum and cerebrospinal fluid levels of visinin-like protein-1 in acute encephalopathy with biphasic seizures and late reduced diffusion.
23800322 2013 CSF levels of the neuronal injury biomarker visinin-like protein-1 in Alzheimer's disease and dementia with Lewy bodies.
22832524 2011 Association of VSNL1 with schizophrenia, frontal cortical function, and biological significance for its gene product as a modulator of cAMP levels and neuronal morphology.
22357717 2012 CSF VILIP-1 predicts rates of cognitive decline in early Alzheimer disease.
22331379 2012 Visinin-like 1 is upregulated in aldosterone-producing adenomas with KCNJ5 mutations and protects from calcium-induced apoptosis.
22052372 2012 Visinin-like protein-1 overexpression is an indicator of lymph node metastasis and poor prognosis in colorectal cancer patients.
22005930 2012 Genome-wide association study of Alzheimer's disease with psychotic symptoms.
21823155 2011 Visinin-like protein-1: diagnostic and prognostic biomarker in Alzheimer disease.
21269460 2011 Initial characterization of the human central proteome.
21169352 2011 Structural analysis of Mg2+ and Ca2+ binding, myristoylation, and dimerization of the neuronal calcium sensor and visinin-like protein 1 (VILIP-1).
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
20079378 2010 Visinin-like protein 1 regulates natriuretic peptide receptor B in the heart.
19674972 2009 Promoter regulation of the visinin-like subfamily of neuronal calcium sensor proteins by nuclear respiratory factor-1.
19065602 2009 Regulatory elements and functional implication for the formation of dimeric visinin-like protein-1.
19063970 2009 Neuronal Ca2+ sensor VILIP-1 leads to the upregulation of functional alpha4beta2 nicotinic acetylcholine receptors in hippocampal neurons.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18922787 2008 Regulation of P2X2 receptors by the neuronal calcium sensor VILIP1.
18703769 2008 The brain injury biomarker VLP-1 is increased in the cerebrospinal fluid of Alzheimer disease patients.
18691652 2008 Implication of neuronal Ca2+ -sensor protein VILIP-1 in the glutamate hypothesis of schizophrenia.
18301774 2008 VILIP-1 downregulation in non-small cell lung carcinomas: mechanisms and prediction of survival.
17615261 2007 Involvement of visinin-like protein-1 (VSNL-1) in regulating proliferative and invasive properties of neuroblastoma.
16731532 2006 The neuronal Ca2+ sensor protein visinin-like protein-1 is expressed in pancreatic islets and regulates insulin secretion.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16703469 2006 Functional contribution of Ca2+ and Mg2+ to the intermolecular interaction of visinin-like proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15735716 2005 Visinin-like protein-1 is a potent inhibitor of cell adhesion and migration in squamous carcinoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12681369 2003 Group I mGlu receptors regulate the expression of the neuronal calcium sensor protein VILIP-1 in vitro and in vivo: implications for mGlu receptor-dependent hippocampal plasticity?
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445467 2002 Evidence for different functional properties of the neuronal calcium sensor proteins VILIP-1 and VILIP-3: from subcellular localization to cellular function.
12202488 2002 The calcium sensor protein visinin-like protein-1 modulates the surface expression and agonist sensitivity of the alpha 4beta 2 nicotinic acetylcholine receptor.
12200122 2002 Functional analysis of calcium-binding EF-hand motifs of visinin-like protein-1.
12196554 2002 Reversible translocation and activity-dependent localization of the calcium-myristoyl switch protein VILIP-1 to different membrane compartments in living hippocampal neurons.
11592857 2001 The neuronal calcium sensor protein VILIP-1 is associated with amyloid plaques and extracellular tangles in Alzheimer's disease and promotes cell death and tau phosphorylation in vitro: a link between calcium sensors and Alzheimer's disease?
11579136 2001 Intracellular neuronal calcium sensor (NCS) protein VILIP-1 modulates cGMP signalling pathways in transfected neural cells and cerebellar granule neurones.
10851344 1999 Regional and cellular distribution of neural visinin-like protein immunoreactivities (VILIP-1 and VILIP-3) in human brain.
10520747 1998 Isolation of two human cDNAs, HLP3 and HLP4, homologous to the neuron-specific calcium-binding protein genes.
9109541 1997 The neuronal calcium-sensor protein VILIP modulates cyclic AMP accumulation in stably transfected C6 glioma cells: amino-terminal myristoylation determines functional activity.
8780737 1996 The neuronal EF-hand Ca(2+)-binding protein VILIP: interaction with cell membrane and actin-based cytoskeleton.
8530085 1995 Sequence characterization and genetic mapping of the human VSNL1 gene, a homologue of the rat visinin-like peptide RNVP1.
2202488 1990 Electron microscopic localization of gamma- and beta II-subspecies of protein kinase C in rat hippocampus.
1375457 1992 cDNA cloning of a neural visinin-like Ca(2+)-binding protein.