Property Summary

NCBI Gene PubMed Count 17
PubMed Score 683.70
PubTator Score 88.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -3.332 1.0e-05
chronic lymphosyte leukemia -1.200 8.5e-10
group 4 medulloblastoma -2.200 5.5e-07
atypical teratoid/rhabdoid tumor -2.000 6.2e-10
medulloblastoma, large-cell -2.700 9.5e-08
primitive neuroectodermal tumor -1.300 3.0e-03
primary pancreatic ductal adenocarcinoma 1.385 1.1e-03
tuberculosis 2.500 9.1e-07
non-small cell lung cancer -1.358 6.1e-19
X-linked cerebral adrenoleukodystrophy -1.100 4.7e-02
lung adenocarcinoma -1.100 2.6e-14
lung carcinoma -1.300 7.5e-28
ductal carcinoma in situ -1.100 7.4e-04
invasive ductal carcinoma -1.100 3.9e-03
ovarian cancer -2.000 9.6e-15

Gene RIF (3)

PMID Text
26228159 p53-induced expression of DD1alpha prevents persistence of cell corpses and ensures efficient generation of precise immune responses in mice.
25279955 overexpression of the newly described co-stimulatory molecule, PD1 homologue (PD-1H) in human monocyte/macrophages is sufficient to induce spontaneous secretion of multiple cytokines.
20666777 Results suggest that GI24 contributes to tumor-invasive growth in the collagen matrix by augmenting cell surface MT1-MMP.

AA Sequence

MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK      1 - 70
TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD     71 - 140
SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPL    141 - 210
ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS    211 - 280
EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI                                           281 - 311
//

Text Mined References (23)

PMID Year Title
26228159 2015 Control of signaling-mediated clearance of apoptotic cells by the tumor suppressor p53.
25279955 2014 Characterization of programmed death-1 homologue-1 (PD-1H) expression and function in normal and HIV infected individuals.
24691993 2014 VISTA is an immune checkpoint molecule for human T cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22488247 2012 Evolution of the B7 family: co-evolution of B7H6 and NKp30, identification of a new B7 family member, B7H7, and of B7's historical relationship with the MHC.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
20666777 2010 GI24 enhances tumor invasiveness by regulating cell surface membrane-type 1 matrix metalloproteinase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.