Property Summary

NCBI Gene PubMed Count 19
PubMed Score 747.85
PubTator Score 88.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 6.6e-06
chronic lymphosyte leukemia -1.200 8.5e-10
ductal carcinoma in situ -1.100 7.4e-04
group 3 medulloblastoma -2.000 8.5e-05
invasive ductal carcinoma -1.100 3.9e-03
lung adenocarcinoma -1.100 2.6e-14
lung carcinoma -1.300 7.5e-28
medulloblastoma, large-cell -2.200 9.4e-06
non-small cell lung cancer -1.137 9.7e-18
osteosarcoma -3.332 1.0e-05
ovarian cancer -1.700 4.2e-09
primary pancreatic ductal adenocarcinoma 1.385 1.1e-03
primitive neuroectodermal tumor -1.300 3.0e-03
tuberculosis 2.500 9.1e-07
X-linked cerebral adrenoleukodystrophy -1.100 4.7e-02

Gene RIF (5)

AA Sequence

MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK      1 - 70
TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD     71 - 140
SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPL    141 - 210
ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS    211 - 280
EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI                                           281 - 311
//

Text Mined References (25)

PMID Year Title