Property Summary

NCBI Gene PubMed Count 26
PubMed Score 34.22
PubTator Score 25.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
25687755 Data indicate that rotein kinase calpha (PKCalpha) plays a role in downregulating complement receptor Ig (CRIg coded by V-set and Ig domain-containing protein 4 VSIG4) expression.
25114177 complement receptor of the immunoglobulin superfamily-L-factor H protects glomerular mesangial cells from complement-mediated injury and proliferative lesions
24862966 Data indicate that massive V-set and Ig domain-containing 4 VSIG4(+) cell infiltration throughout the non-small-cell lung cancer samples.
24349325 we identified VSIG4 as a potential diagnostic marker of severe preeclampsia. The determination of this gene may improve the prognostic assessment of severe preeclampsia.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of V-set and immunoglobulin domain containing 4 (VSIG4) in peptide-treated PBMCs
23284715 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of V-set and immunoglobulin domain containing 4 (VSIG4) in peptide-treated PBMCs
21768202 we showed that a complement receptor of the Ig superfamily (CRIg, also known as Z39Ig), a receptor for complement fragments (C3b and iC3b), was expressed on a subset of intestinal macrophages in murine and human large intestine
20399148 These results suggest that T cells can opposite T cell hyporesponsiveness through dampening Z39Ig inhibitory signals from macrophages and thus maintain their anti-viral function in chronic hepatitis B.
19914289 hVSIG4 recombinant adenovirus-transfected DCs suppress T cell proliferation, cytokine production and activation marker expression with
17051150 CRIg is not only a phagocytic receptor, but also a potent inhibitor of the alternative pathway convertases
17016562 The specific expression of VSIG4 on resting macrophages suggests that VSIG4 may be important for the maintenance of T cell unresponsiveness in healthy tissues.
16882875 These data indicate that the macrophage Z39Ig is involved in the pathogenesis of inflammatory diseases through chemokine induction, which will promote the migration of inflammatory cells into the lesion area, and MMP-9 induction.
16530040 Results report the identification and characterization of a Complement Receptor of the Immunoglobulin superfamily, CRIg, that binds complement fragments C3b and iC3b.

AA Sequence

MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLR      1 - 70
DSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSV     71 - 140
SKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYF    141 - 210
CTAKGQVGSEQHSDIVKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGK    211 - 280
SLPVFAIILIISLCCMVVFTMAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTS    281 - 350
QNLGNNYSDEPCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC                         351 - 399
//

Text Mined References (27)

PMID Year Title
25687755 2015 Protein kinase c? regulates the expression of complement receptor Ig in human monocyte-derived macrophages.
25114177 2014 A novel CRIg-targeted complement inhibitor protects cells from complement damage.
24862966 2014 VSIG4 expression on macrophages facilitates lung cancer development.
24349325 2013 Evaluation of current and new biomarkers in severe preeclampsia: a microarray approach reveals the VSIG4 gene as a potential blood biomarker.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21768202 2012 Phenotypic and functional profiles of CRIg (Z39Ig)-expressing macrophages in the large intestine.
20399148 2010 Down-regulation of Z39Ig on macrophages by IFN-gamma in patients with chronic HBV infection.
19914289 2010 Induction of T cells suppression by dendritic cells transfected with VSIG4 recombinant adenovirus.
19797726 2010 T-cell/histiocyte-rich large B-cell lymphoma shows transcriptional features suggestive of a tolerogenic host immune response.
18752851 2008 A role of macrophage complement receptor CRIg in immune clearance and inflammation.
18727628 2008 Expansion of a unique macrophage subset in rheumatoid arthritis synovial lining layer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17051150 2006 Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
17016562 2006 VSIG4, a B7 family-related protein, is a negative regulator of T cell activation.
17016555 2006 To be or not to be B7.
16882875 2006 Z39Ig is expressed on macrophages and may mediate inflammatory reactions in arthritis and atherosclerosis.
16530040 2006 CRIg: a macrophage complement receptor required for phagocytosis of circulating pathogens.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16009265 2005 Characterization of monoclonal antibody specific to the Z39Ig protein, a member of immunoglobulin superfamily.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11997108 2002 Z39Ig is co-expressed with activated macrophage genes.
11004523 2000 Cloning of Z39Ig, a novel gene with immunoglobulin-like domains located on human chromosome X.