Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.16
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 7.4e-17
group 3 medulloblastoma 4002 2.3e-05
osteosarcoma 7766 1.3e-04
oligodendroglioma 2768 4.0e-03
inflammatory breast cancer 272 7.5e-03
ependymoma 4559 8.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 8.7e-03
group 3 medulloblastoma -2.400 2.3e-05
inflammatory breast cancer -2.000 7.5e-03
oligodendroglioma -1.300 4.0e-03
osteosarcoma -1.459 1.3e-04
psoriasis 1.100 7.4e-17

Gene RIF (1)

AA Sequence

MDNPQALPLFLLLASLVGILTLRASSGLQQTNFSSAFSSDSKSSSQGLGVEVPSIKPPSWKVPDQFLDSK      1 - 70
ASAGISDSSWFPEALSSNMSGSFWSNVSAEGQDLSPVSPFSETPGSEVFPDISDPQVPAKDPKPSFTVKT     71 - 140
PASNISTQVSHTKLSVEAPDSKFSPDDMDLKLSAQSPESKFSAETHSAASFPQQVGGPLAVLVGTTIRLP    141 - 210
LVPIPNPGPPTSLVVWRRGSKVLAAGGLGPGAPLISLDPAHRDHLRFDQARGVLELASAQLDDAGVYTAE    211 - 280
VIRAGVSQQTHEFTVGVYEPLPQLSVQPKAPETEEGAAELRLRCLGWGPGRGELSWSRDGRALEAAESEG    281 - 350
AETPRMRSEGDQLLIVRPVRSDHARYTCRVRSPFGHREAAADVSVFYGPDPPTITVSSDRDAAPARFVTA    351 - 420
GSNVTLRCAAASRPPADITWSLADPAEAAVPAGSRLLLPAVGPGHAGTYACLAANPRTGRRRRSLLNLTV    421 - 490
ADLPPGAPQCSVEGGPGDRSLRFRCSWPGGAPAASLQFQGLPEGIRAGPVSSVLLAAVPAHPRLSGVPIT    491 - 560
CLARHLVATRTCTVTPEAPREVLLHPLVAETRLGEAEVALEASGCPPPSRASWAREGRPLAPGGGSRLRL    561 - 630
SQDGRKLHIGNFSLDWDLGNYSVLCSGALGAGGDQITLIGPSISSWRLQRARDAAVLTWDVERGALISSF    631 - 700
EIQAWPDGPALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVYRAGP    701 - 770
TLSHGAIAGIVLGSLLGLALLAVLLLLCICCLCRFRGKTPEKKKHPSTLVPVVTPSEKKMHSVTPVEISW    771 - 840
PLDLKVPLEDHSSTRAYQAQTPVQLSL                                               841 - 867
//

Text Mined References (4)

PMID Year Title