Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.30
PubTator Score 3.38

Knowledge Summary

Patent (679)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Vaccinia 32 4.831 2.4

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.300 3.2e-04
Astrocytoma, Pilocytic -1.600 2.0e-08
atypical teratoid/rhabdoid tumor -1.300 1.1e-05
ependymoma -1.300 6.1e-03
glioblastoma -1.300 9.4e-10
group 3 medulloblastoma -1.300 5.5e-03
osteosarcoma -1.057 2.9e-04
Pick disease -1.100 8.9e-06
tuberculosis -1.100 3.8e-04

Gene RIF (3)

AA Sequence

MISFCPDCGKSIQAAFKFCPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVT      1 - 70
SPRLSLFSDGDSSESEDTLSSSERSKGSGSRPPTPKSSPQKTRKSPQVTRGSPQKTSCSPQKTRQSPQTL     71 - 140
KRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTRDNQGILYEAAPTSTLTCDSGPQKQKFSLKLDAKDGR    141 - 210
LFNEQNFFQRAAKPLQVNKWKKLYSTPLLAIPTCMGFGVHQDKYRFLVLPSLGRSLQSALDVSPKHVLSE    211 - 280
RSVLQVACRLLDALEFLHENEYVHGNVTAENIFVDPEDQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPH    281 - 350
EGDLEFISMDLHKGCGPSRRSDLQSLGYCMLKWLYGFLPWTNCLPNTEDIMKQKQKFVDKPGPFVGPCGH    351 - 420
WIRPSETLQKYLKVVMALTYEEKPPYAMLRNNLEALLQDLRVSPYDPIGLPMVP                    421 - 474
//

Text Mined References (23)

PMID Year Title