Property Summary

NCBI Gene PubMed Count 15
PubMed Score 134.13
PubTator Score 28.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 4.5e-06
osteosarcoma 1.273 6.8e-03
group 3 medulloblastoma 1.300 3.0e-05
tuberculosis and treatment for 6 months -1.200 4.2e-04
lung cancer 1.400 4.3e-04
lung adenocarcinoma 1.200 4.6e-12
acute myeloid leukemia -1.800 2.9e-02
ovarian cancer 1.400 1.1e-04

Gene RIF (2)

PMID Text
26974126 The 2.7-A-resolution crystal structure of the human YL1-H2A.Z-H2B complex shows that YL1 binding, similarly to ANP32E binding, triggers an extension of the H2A.Z alphaC helix.
15647280 Results identify YL1 as a subunit of the TRRAP/TIP60 HAT complex, and also as a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.

AA Sequence

MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPS      1 - 70
SDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEH     71 - 140
TRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGP    141 - 210
IITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQ    211 - 280
GRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLP    281 - 350
GSGPRALRQKIVIK                                                            351 - 364
//

Text Mined References (18)

PMID Year Title
26974126 2016 Molecular basis and specificity of H2A.Z-H2B recognition and deposition by the histone chaperone YL1.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22096247 2012 Integrin-?v?3 regulates thrombopoietin-mediated maintenance of hematopoietic stem cells.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7702631 1995 Molecular cloning of a novel human cDNA on chromosome 1q21 and its mouse homolog encoding a nuclear protein with DNA-binding ability.
7664828 1995 Forced expression of YL-1 protein suppresses the anchorage-independent growth of Kirsten sarcoma virus-transformed NIH3T3 cells.