Property Summary

NCBI Gene PubMed Count 15
PubMed Score 143.50
PubTator Score 28.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.800 2.9e-02
group 3 medulloblastoma 1.300 3.0e-05
lung adenocarcinoma 1.200 4.6e-12
lung cancer 1.400 4.3e-04
malignant mesothelioma 1.400 4.5e-06
osteosarcoma 1.273 6.8e-03
ovarian cancer 1.400 1.1e-04
tuberculosis and treatment for 6 months -1.200 4.2e-04

Gene RIF (2)

AA Sequence

MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPS      1 - 70
SDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEH     71 - 140
TRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGP    141 - 210
IITYHSVTVPLVGEPGPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQ    211 - 280
GRPPKVPVREVCPVTHRPALYRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLP    281 - 350
GSGPRALRQKIVIK                                                            351 - 364
//

Text Mined References (19)

PMID Year Title