Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.39
PubTator Score 23.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.8e-04
Waldenstrons macroglobulinemia 1.082 4.8e-03
Multiple myeloma 1.051 3.5e-03
astrocytic glioma -2.000 2.0e-02
ependymoma -1.900 2.7e-02
oligodendroglioma -1.500 2.9e-02
osteosarcoma -1.196 3.4e-02
glioblastoma -1.300 2.2e-04
medulloblastoma, large-cell -1.600 4.6e-03
ovarian cancer -1.500 4.4e-07

Gene RIF (6)

PMID Text
25445562 VPS41 subunit of HOPS complex was defined to be the major partner for interacting with RILP.
23322049 hVps41 and VAMP7 are specifically involved in the fusion of trans-Golgi network-derived lysosome-associated membrane protein carriers with late endosomes.
23167963 Vps41 knockdown impairs late endosome fusion and fusion between late endosomes and lysosomes.
22323726 Both a functional heterotetrameric adaptor protein complex and a homotypic fusion and vacuole protein sorting-tethering complex are required for VPS41 to elicit neuroprotection in a transgenic model of Parkinson's disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19850127 These data show that hVPS41 is protective against both alpha-syn and neurotoxic-mediated injury in invertebrate and cellular models of PD.

AA Sequence

MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLL      1 - 70
DVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFVRSS     71 - 140
CKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWANNMGVKIFDIISKQRITNVPRDD    141 - 210
ISLRPDMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQ    211 - 280
LVVLSYVKEISEKTEREYCARPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVS    281 - 350
PRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQK    351 - 420
ILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNN    421 - 490
SVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLM    491 - 560
DFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLP    561 - 630
FLRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLI    631 - 700
LYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLS    701 - 770
LLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSA    771 - 840
KNRGPGSAILEMKK                                                            841 - 854
//

Text Mined References (27)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25908847 2015 The small GTPase Arl8b regulates assembly of the mammalian HOPS complex on lysosomes.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
25445562 2014 RILP interacts with HOPS complex via VPS41 subunit to regulate endocytic trafficking.
24210660 2013 Self-assembly of VPS41 promotes sorting required for biogenesis of the regulated secretory pathway.
23918659 2013 Vps33b pathogenic mutations preferentially affect VIPAS39/SPE-39-positive endosomes.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
23322049 2013 hVps41 and VAMP7 function in direct TGN to late endosome transport of lysosomal membrane proteins.
23167963 2013 The HOPS proteins hVps41 and hVps39 are required for homotypic and heterotypic late endosome fusion.
22323726 2012 Functional analysis of VPS41-mediated neuroprotection in Caenorhabditis elegans and mammalian models of Parkinson's disease.
21411634 2011 Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells.
20434987 2010 Identification of the switch in early-to-late endosome transition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19850127 2010 VPS41, a protein involved in lysosomal trafficking, is protective in Caenorhabditis elegans and mammalian cellular models of Parkinson's disease.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19109425 2009 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery.
17897319 2007 Integral and associated lysosomal membrane proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11412045 2001 hVPS41 is expressed in multiple isoforms and can associate with vesicles through a RING-H2 finger motif.
10559961 1999 Formation of AP-3 transport intermediates requires Vps41 function.
9847074 1998 Toward a complete human genome sequence.
9159129 1997 Characterization of VPS41, a gene required for vacuolar trafficking and high-affinity iron transport in yeast.
7596406 1995 Cloning of a gene bearing missense mutations in early-onset familial Alzheimer's disease.