Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.16
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.6e-29
Disease Target Count Z-score Confidence
Williams-Beuren syndrome 45 4.246 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.6e-29

Synonym

Accession Q86XT2 Q6P2C3
Symbols WBSCR24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

AA Sequence

MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKENLA      1 - 70
LRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLG     71 - 140
EQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQPAPTSAADPPKSFPAAAVLPTGAARGPPAV    141 - 210
PRSLPPLDSRPVPPLKGSPGCPLGPAPLLSPRPSQPEPPHR                                 211 - 251
//

Text Mined References (13)

PMID Year Title
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22405001 2012 The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.