Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.29
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.6e-05
psoriasis 6694 3.2e-05
tuberculosis 2010 8.6e-05
invasive ductal carcinoma 2951 3.6e-04
breast carcinoma 1638 9.2e-04
osteosarcoma 7950 1.5e-02

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.300 9.2e-04
invasive ductal carcinoma 1.400 3.6e-04
osteosarcoma -1.014 1.5e-02
ovarian cancer -1.200 2.6e-05
psoriasis 1.700 3.2e-05
tuberculosis -1.200 8.6e-05

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (4)

AA Sequence

METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPLEISRSNLSDR      1 - 70
YQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAEKFLEGEVPLETFLENFSSMR     71 - 140
MLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVRPVPQGTPPVVEEQPQPPLAMPPYPLPYSPS    141 - 210
PSLPVGPTAHGALPPAPFPVVSQPSFYSGPLGPTYPAAQLGPRGAAGYSWSPQRSMPPRPGYPGTPMGAS    211 - 280
GPGYPLRGGRAPSPGYPQQSPYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGP    281 - 350
AWPGY                                                                     351 - 355
//

Text Mined References (22)

PMID Year Title