Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.80
PubTator Score 1.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
23924735 VPS37B and appeared to interact with ALG-2 in a stronger manner than TSG101 does.
23895345 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
23305486 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
23027949 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
22004035 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
21762798 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18005716 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101
15218037 GST-fused NCp6 fragment binds ESCRT-I subunits such as MVB12B, VPS37B, VPS28, and TSG101

AA Sequence

MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNLLYQPQLDTLK      1 - 70
ARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEEDTENMAEKFLDGELPLDSFID     71 - 140
VYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRLPELAPTAPLPYPAPEASGPPAVAPRRIPPP    141 - 210
PPPVPAGRLATPFTAAMSSGQAVPYPGLQCPPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQP    211 - 280
GFILQ                                                                     281 - 285
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22405001 2012 The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19129479 2009 Biochemical analyses of human IST1 and its function in cytokinesis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
17940959 2007 Involvement of vacuolar protein sorting pathway in Ebola virus release independent of TSG101 interaction.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.