Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.92
PubTator Score 5.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.300 2.9e-02
posterior fossa group A ependymoma -1.300 1.6e-08
glioblastoma -2.000 7.1e-07
atypical teratoid / rhabdoid tumor -1.500 3.3e-07
non-small cell lung cancer -1.134 4.0e-21
pediatric high grade glioma -1.600 1.6e-07
Pick disease -1.600 6.2e-05
Breast cancer -1.300 2.0e-07
ovarian cancer -1.800 1.3e-07

Gene RIF (4)

PMID Text
26268989 Knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 secretion when using wild type (HIV-1 LAI) and VSV-pseudotyped virus
26268989 shRNA knockdown of VPS36 (ESCRT-II component) decreases HIV-1 CA-p24 supernatant levels when using wild type (HIV-1 LAI) and VSV-pseudotyped virus; HIV replication is enhanced by VPS36
17057716 Crystallographic and biochemical analyses reveal that the GLUE domain of the human ESCRT-II EAP45 (also called VPS36) subunit is a split pleckstrin-homology domain that binds ubiquitin along one edge of the beta-sandwich.
16371348 mammalian ESCRTII is made up of hVps25p, hVps22p, and hVps36p and may be redundant, cargo-specific, or not required for protein sorting at the multivesicular body

AA Sequence

MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIE      1 - 70
EQAAGIGKSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSL     71 - 140
QTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIANKIKDKQGDIT    141 - 210
EDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGME    211 - 280
LLSPEDLVNACKMLEALKLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV    281 - 350
LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS                                      351 - 386
//

Text Mined References (25)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20682791 2010 A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18539118 2008 Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17714434 2007 Vps22/EAP30 in ESCRT-II mediates endosomal sorting of growth factor and chemokine receptors destined for lysosomal degradation.
17057716 2006 Structural basis for ubiquitin recognition by the human ESCRT-II EAP45 GLUE domain.
17010938 2006 RILP interacts with VPS22 and VPS36 of ESCRT-II and regulates their membrane recruitment.
16973552 2006 Human ESCRT-II complex and its role in human immunodeficiency virus type 1 release.
16371348 2006 Degradation of endocytosed epidermal growth factor and virally ubiquitinated major histocompatibility complex class I is independent of mammalian ESCRTII.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15755741 2005 Eap45 in mammalian ESCRT-II binds ubiquitin via a phosphoinositide-interacting GLUE domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278625 2001 Cloning and characterization of ELL-associated proteins EAP45 and EAP20. a role for yeast EAP-like proteins in regulation of gene expression by glucose.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.