Property Summary

NCBI Gene PubMed Count 20
PubMed Score 9.39
PubTator Score 4.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 9.1e-12
psoriasis 6685 6.5e-06
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 43 5.253 2.6
ARC syndrome 14 4.119 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -3.100 6.5e-06
osteosarcoma -2.334 9.1e-12

Gene RIF (4)

PMID Text
25783203 association of VPS33A with HOPS via its interaction with VPS16 is required for both endosome- and autophagosome-lysosome fusion
22203954 Melanoma cells depleted of vacuolar protein sorting 33A protein have increased nuclear localization of cis-diaminedichloroplatinum II, increased nuclear DNA damage by platination, and increased apoptosis, resulting in increased treatment sensitivity.
15790593 A and B classes reflect the evolution of organelle/tissue-specific functions
12538872 VPS33A is mutated in Hermansky-Pudlak syndrome and may have a role in melanogenesis

AA Sequence

MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNR      1 - 70
LPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEY     71 - 140
SLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMK    141 - 210
REFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDL    211 - 280
PTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGS    281 - 350
LANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGL    351 - 420
KQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQNPTDISYVYS    421 - 490
GYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAA    491 - 560
LRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF                                      561 - 596
//

Text Mined References (25)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
25266290 2014 Mammalian CORVET is required for fusion and conversion of distinct early endosome subpopulations.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
22203954 2012 Targeting protein-trafficking pathways alters melanoma treatment sensitivity.
21411634 2011 Clathrin-dependent mechanisms modulate the subcellular distribution of class C Vps/HOPS tether subunits in polarized and nonpolarized cells.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
20434987 2010 Identification of the switch in early-to-late endosome transition.
20190753 2010 Mutations in VIPAR cause an arthrogryposis, renal dysfunction and cholestasis syndrome phenotype with defects in epithelial polarization.
19109425 2009 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery.
18552835 2008 Beclin1-binding UVRAG targets the class C Vps complex to coordinate autophagosome maturation and endocytic trafficking.
17897319 2007 Integral and associated lysosomal membrane proteins.
15790593 2005 Comparative evolutionary analysis of VPS33 homologues: genetic and functional insights.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12538872 2003 The mouse organellar biogenesis mutant buff results from a mutation in Vps33a, a homologue of yeast vps33 and Drosophila carnation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11382755 2001 Molecular characterization of mammalian homologues of class C Vps proteins that interact with syntaxin-7.
11250079 2001 Molecular cloning and characterization of human VPS18, VPS 11, VPS16, and VPS33.
8996080 1996 Mammalian homologues of yeast vacuolar protein sorting (vps) genes implicated in Golgi-to-lysosome trafficking.