Property Summary

NCBI Gene PubMed Count 33
PubMed Score 33.83
PubTator Score 19.93

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
hereditary spastic paraplegia -1.108 5.8e-03
primary pancreatic ductal adenocarcinoma 1.119 9.4e-03
breast carcinoma 1.200 3.7e-02
ovarian cancer -1.600 7.7e-05
pancreatic cancer 1.200 2.6e-03

 GO Function (1)

Gene RIF (9)

PMID Text
25937119 Data indicate that vesicular transport proteins VPS35 and VPS29 influence the levels of the other subunit of retromer.
25475142 This study demonstrated that Genetic variability of VPS29 in parkinsonism.
24684791 Mutations in the gene composing the retromer cargo recognition subunit are not a common cause of Parkinson's disease.
21629666 Conclusion is that VPS29 is a metal ion-independent, rigid scaffolding domain, which is essential but not sufficient for incorporation of retromer into functional endosomal transport assemblies.
19531583 Membrane recruitment of the cargo-selective retromer subcomplex VPS35/29/26 is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.
17891154 crystal structure of a VPS29-VPS35 subcomplex showing how the metallophosphoesterase-fold subunit VPS29 acts as a scaffold for the carboxy-terminal half of VPS35
17101778 These observations indicate that the mammalian retromer complex assembles by sequential association of SNX1/2 and Vps26-Vps29-Vps35 subcomplexes on endosomal membranes and that SNX1 and SNX2 play interchangeable but essential roles.
16737443 It was demonstrated that recombinant human Vps29 displays in vitro phosphatase activity towards a serine-phosphorylated peptide, containing the acidic-cluster dileucine motif of the cytoplasmatic tail of the CI-M6PR.
15788412 analysis of the phosphodiesterase/nuclease-like fold and two protein-protein interaction sites in human VPS29

AA Sequence

MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYP      1 - 70
EQKVVTVGQFKIGLIHGHQVIPWGDMASLALLQRQFDVDILISGHTHKFEAFEHENKFYINPGSATGAYN     71 - 140
ALETNIIPSFVLMDIQASTVVTYVYQLIGDDVKVERIEYKKP                                141 - 182
//

Text Mined References (40)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25937119 2015 VPS29-VPS35 intermediate of retromer is stable and may be involved in the retromer complex assembly process.
25475142 2015 Genetic variability of the retromer cargo recognition complex in parkinsonism.
25416956 2014 A proteome-scale map of the human interactome network.
24856514 2014 VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface.
24684791 2014 Genetic variation of the retromer subunits VPS26A/B-VPS29 in Parkinson's disease.
24603492 2014 TBC1D5 and the AP2 complex regulate ATG9 trafficking and initiation of autophagy.
24344282 2014 A mechanism for retromer endosomal coat complex assembly with cargo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563491 2013 A global analysis of SNX27-retromer assembly and cargo specificity reveals a function in glucose and metal ion transport.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23331060 2013 Endosomal recruitment of the WASH complex: active sequences and mutations impairing interaction with the retromer.
21725319 2011 A SNX3-dependent retromer pathway mediates retrograde transport of the Wnt sorting receptor Wntless and is required for Wnt secretion.
21629666 2011 VPS29 is not an active metallo-phosphatase but is a rigid scaffold required for retromer interaction with accessory proteins.
21269460 2011 Initial characterization of the human central proteome.
20923837 2010 The cargo-selective retromer complex is a recruiting hub for protein complexes that regulate endosomal tubule dynamics.
19619496 2009 The retromer coat complex coordinates endosomal sorting and dynein-mediated transport, with carrier recognition by the trans-Golgi network.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19531583 2009 Membrane recruitment of the cargo-selective retromer subcomplex is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.
17891154 2007 Functional architecture of the retromer cargo-recognition complex.
17101778 2007 Interchangeable but essential functions of SNX1 and SNX2 in the association of retromer with endosomes and the trafficking of mannose 6-phosphate receptors.
16737443 2006 The human Vps29 retromer component is a metallo-phosphoesterase for a cation-independent mannose 6-phosphate receptor substrate peptide.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16381901 2006 The LIFEdb database in 2006.
15788412 2005 Crystal structure of human vacuolar protein sorting protein 29 reveals a phosphodiesterase/nuclease-like fold and two protein-protein interaction sites.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15282546 2004 Exportin 7 defines a novel general nuclear export pathway.
15247922 2004 The mammalian retromer regulates transcytosis of the polymeric immunoglobulin receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11102511 2000 Human orthologs of yeast vacuolar protein sorting proteins Vps26, 29, and 35: assembly into multimeric complexes.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11062004 2000 Human homologues of yeast vacuolar protein sorting 29 and 35.
9700157 1998 A membrane coat complex essential for endosome-to-Golgi retrograde transport in yeast.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.