Property Summary

NCBI Gene PubMed Count 41
PubMed Score 15.21
PubTator Score 15.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.9e-07
osteosarcoma 7933 1.3e-06
Multiple myeloma 1327 1.1e-03
diabetes mellitus 1663 1.2e-03

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.196 1.1e-03
osteosarcoma -1.715 1.3e-06
diabetes mellitus -1.200 1.2e-03
ovarian cancer 2.600 2.9e-07

Gene RIF (15)

PMID Text
25170077 USP8, and the endosomal sorting protein, VPS28, are the negative regulators of NOD2-induced IL-8 secretion.
25098452 CIIA attenuates neurotoxicity caused by OGD/R through inhibiting ASK1-dependent signaling events.
24522193 CIIA functions as a negative modulator of the SOS1-Ras signaling events initiated by peptide growth factors including EGF.
23895345 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
23305486 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
23027949 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
22004035 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
21762798 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
20708039 Data show that gamma2-adaptin in MVB sorting specifically interacts with the ESCRT subunits Vps28 and CHMP2A.
19524996 Overall, we see no role for the ESCRT pathway in influenza virus budding and the significance of the M1-VPS28 interaction remains to be determined.
18005716 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
17982468 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
16940516 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
15218037 ESCRT-I complexes contain three common subunits (TSG101, VPS28, and VPS37), and a fourth subunit MVB12. Recombinant ESCRT-I complexes bind HIV-1 p6
12857913 EIAV Gag interacts with a cellular component of the VPS machinery, VPS28, to accomplish efficient particle release

AA Sequence

MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC      1 - 70
SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM     71 - 140
DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES    141 - 210
AYNAFNRFLHA                                                               211 - 221
//

Text Mined References (44)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25170077 2014 A genome-wide small interfering RNA (siRNA) screen reveals nuclear factor-?B (NF-?B)-independent regulators of NOD2-induced interleukin-8 (IL-8) secretion.
25098452 2014 CIIA negatively regulates neuronal cell death induced by oxygen-glucose deprivation and reoxygenation.
24522193 2014 CIIA negatively regulates the Ras-Erk1/2 signaling pathway through inhibiting the Ras-specific GEF activity of SOS1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22232651 2012 Structural basis for membrane targeting by the MVB12-associated ?-prism domain of the human ESCRT-I MVB12 subunit.
21757351 2011 UBAP1 is a component of an endosome-specific ESCRT-I complex that is essential for MVB sorting.
21596998 2011 Solution structure of the ESCRT-I complex by small-angle X-ray scattering, EPR, and FRET spectroscopy.
21269460 2011 Initial characterization of the human central proteome.
20708039 2010 ?2-Adaptin is functioning in the late endosomal sorting pathway and interacts with ESCRT-I and -III subunits.
20654576 2010 Distinct functions of human MVB12A and MVB12B in the ESCRT-I dependent on their posttranslational modifications.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19524996 2009 Budding of filamentous and non-filamentous influenza A virus occurs via a VPS4 and VPS28-independent pathway.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19060904 2009 An empirical framework for binary interactome mapping.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18539118 2008 Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex.
18077552 2008 Regulation of Tsg101 expression by the steadiness box: a role of Tsg101-associated ligase.
18005716 2007 Identification of human MVB12 proteins as ESCRT-I subunits that function in HIV budding.
17940959 2007 Involvement of vacuolar protein sorting pathway in Ebola virus release independent of TSG101 interaction.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
16778200 2006 Bcr interacts with components of the endosomal sorting complex required for transport-I and is required for epidermal growth factor receptor turnover.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15509564 2005 Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15240819 2004 The growth-regulatory protein HCRP1/hVps37A is a subunit of mammalian ESCRT-I and mediates receptor down-regulation.
15218037 2004 The human endosomal sorting complex required for transport (ESCRT-I) and its role in HIV-1 budding.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
12892785 2003 Protein sorting into multivesicular endosomes.
12857913 2003 Equine infectious anemia virus utilizes host vesicular protein sorting machinery during particle release.
12663786 2003 Role of ESCRT-I in retroviral budding.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11916981 2002 Mammalian class E vps proteins recognize ubiquitin and act in the removal of endosomal protein-ubiquitin conjugates.
11134028 2001 TSG101/mammalian VPS23 and mammalian VPS28 interact directly and are recruited to VPS4-induced endosomes.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.