Property Summary

NCBI Gene PubMed Count 22
PubMed Score 75.77
PubTator Score 21.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 4.0e-05
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
Plasmacytoma 5 3.704 1.9
ARC syndrome 14 3.555 1.8
Cortical blindness 15 3.53 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.363 4.0e-05

Gene RIF (5)

PMID Text
22761998 The CA domain of HIV-1 Gag and the clathrin heavy-chain repeat domain of VPS18 are required for the interaction between Gag and VPS18
21450827 Depletion of hVps18 or hMon2 reduced the efficient production of infectious HIV-1 virions in human cells.
21450827 The CA domain of HIV-1 Gag and the clathrin heavy-chain repeat domain of VPS18 are required for the interaction between Gag and VPS18
16996030 ubiquitin binding and ubiquitylation of GGA3-GAT domain are mutually inseparable through a ubiquitin ligase activity of hVPS18
16203730 hVPS18 may play an important role in regulation of SNK activity through its ubiquitin ligase

AA Sequence

MASILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSLVVSSNQLCMS      1 - 70
LGKDTLLRIDLGKANEPNHVELGRKDDAKVHKMFLDHTGSHLLIALSSTEVLYVNRNGQKVRPLARWKGQ     71 - 140
LVESVGWNKALGTESSTGPILVGTAQGHIFEAELSASEGGLFGPAPDLYFRPLYVLNEEGGPAPVCSLEA    141 - 210
ERGPDGRSFVIATTRQRLFQFIGRAAEGAEAQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSA    211 - 280
PRAFAWMMGDGVLYGALDCGRPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLT    281 - 350
GQVVLRDHFLEKFGPLKHMVKDSSTGQLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPD    351 - 420
CLDTVLAREADFCFRQRRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLASLKPAERTQATL    421 - 490
LTTWLTELYLSRLGALQGDPEALTLYRETKECFRTFLSSPRHKEWLFASRASIHELLASHGDTEHMVYFA    491 - 560
VIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSPILIRHIPRQLVDAWIEMGSRLDARQLIPAL    561 - 630
VNYSQGGEVQQVSQAIRYMEFCVNVLGETEQAIHNYLLSLYARGRPDSLLAYLEQAGASPHRVHYDLKYA    631 - 700
LRLCAEHGHHRACVHVYKVLELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDV    701 - 770
QTAMACLASCPLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQEL    771 - 840
RGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQRKLGAAPPPAK    841 - 910
GSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFIDPQRYEEEQLSWL           911 - 973
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463206 2015 Characterization of the Mammalian CORVET and HOPS Complexes and Their Modular Restructuring for Endosome Specificity.
25783203 2015 Recruitment of VPS33A to HOPS by VPS16 Is Required for Lysosome Fusion with Endosomes and Autophagosomes.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
23918659 2013 Vps33b pathogenic mutations preferentially affect VIPAS39/SPE-39-positive endosomes.
23901104 2013 Structural basis of Vps33A recruitment to the human HOPS complex by Vps16.
23351085 2013 Tethering complexes in the endocytic pathway: CORVET and HOPS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21450827 2011 The cellular factors Vps18 and Mon2 are required for efficient production of infectious HIV-1 particles.
21269460 2011 Initial characterization of the human central proteome.
20434987 2010 Identification of the switch in early-to-late endosome transition.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19109425 2009 SPE-39 family proteins interact with the HOPS complex and function in lysosomal delivery.
18799622 2008 An FTS/Hook/p107(FHIP) complex interacts with and promotes endosomal clustering by the homotypic vacuolar protein sorting complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18552835 2008 Beclin1-binding UVRAG targets the class C Vps complex to coordinate autophagosome maturation and endocytic trafficking.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17897319 2007 Integral and associated lysosomal membrane proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16996030 2006 Monoubiquitylation of GGA3 by hVPS18 regulates its ubiquitin-binding ability.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16203730 2005 Ubiquitylation and degradation of serum-inducible kinase by hVPS18, a RING-H2 type ubiquitin ligase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14623309 2003 Identification of mouse Vps16 and biochemical characterization of mammalian class C Vps complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11382755 2001 Molecular characterization of mammalian homologues of class C Vps proteins that interact with syntaxin-7.
11250079 2001 Molecular cloning and characterization of human VPS18, VPS 11, VPS16, and VPS33.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.