Property Summary

NCBI Gene PubMed Count 20
PubMed Score 210.10
PubTator Score 58.63

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
23881307 VPREB1 focal deletions are common in B-ALL and occur independent of V(D)J light chain recombination. Focal deletions of VPREB1 correlate with decreased expression levels and high-risk patients with focal deletions tend to have poorer overall survival
21144590 The proportion of the individuals with <2 copies of the VPREB1 gene was significantly higher in the patient group than that in the controls, while that of the individuals with >2 copies was lower in the patient group than that in the controls.
20237496 Observational study of gene-disease association. (HuGE Navigator)
16818733 Pre-B cell integrins and their stromal cell ligands together with the pre-B cell receptor and galectin-1 form a homogeneous lattice at the contact area between bone marrow pre-B and stromal cells.
11994467 The 5' region of the VpreB gene contains a promoter which displays higher relative activity in preB cells compared with cells at other stages or from other lineages.

AA Sequence

MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLR      1 - 70
YFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAA     71 - 140
RTRVP                                                                     141 - 145
//

Text Mined References (24)

PMID Year Title
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
23881307 2014 VPREB1 deletions occur independent of lambda light chain rearrangement in childhood acute lymphoblastic leukemia.
21269460 2011 Initial characterization of the human central proteome.
21144590 2011 The potential role of VPREB1 gene copy number variation in susceptibility to rheumatoid arthritis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18287279 2008 Engineering and characterization of a single chain surrogate light chain variable domain.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17431183 2007 Structural insight into pre-B cell receptor function.
16818733 2006 Clustering of pre-B cell integrins induces galectin-1-dependent pre-B cell receptor relocalization and activation.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12271131 2002 Galectin-1 is a stromal cell ligand of the pre-B cell receptor (BCR) implicated in synapse formation between pre-B and stromal cells and in pre-BCR triggering.
11994467 2002 The human V-preB promoter is a target for coordinated activation by early B cell factor and E47.
11564802 2001 Conventional and surrogate light chains differentially regulate Ig mu and Dmu heavy chain maturation and surface expression.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
9058786 1997 Secretion of soluble pre-B cell receptors by pre-B cells.
8020565 1994 Discrete early pro-B and pre-B stages in normal human bone marrow as defined by surface pseudo-light chain expression.
7961773 1994 Molecular components and assembly of mu.surrogate light chain complexes in pre-B cell lines.
7935499 1994 The human pre-B cell receptor: structural constraints for a tentative model of the pseudo-light (psi L) chain.
3258819 1988 Structure and pre-B lymphocyte restricted expression of the VpreB in humans and conservation of its structure in other mammalian species.
3139558 1988 The human Vpre B gene is located on chromosome 22 near a cluster of V lambda gene segments.
2117639 1990 The products of pre-B cell-specific genes (lambda 5 and VpreB) and the immunoglobulin mu chain form a complex that is transported onto the cell surface.
1903358 1991 The human pre-B-specific lambda-like cluster is located in the 22q11.2-22q12.3 region, distal to the IgC lambda locus.