Property Summary

NCBI Gene PubMed Count 24
PubMed Score 17.30
PubTator Score 17.19

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (7)

PMID Text
25398664 VOPP1 is overexpressed in gastric adenocarcinoma, which is involved in promoting cell proliferation and migration and thus might serve as a putative oncogene.
23243056 Upregulation of ECOP is associated with glioma.
21519330 overexpression in cancer participates in the control of the intracellular redox state; its loss leads to oxidative cellular injury leading to cell death by the intrinsic apoptotic pathway
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19525979 Results identify ECOP as a protein relevant to the biology of SCC.
17515955 ECOP was used as a molecular marker in patients with chronic wounds to guide surgical debridement.

AA Sequence

MRRQPAKVAALLLGLLLECTEAKKHCWYFEGLYPTYYICRSYEDCCGSRCCVRALSIQRLWYFWFLLMMG      1 - 70
VLFCCGAGFFIRRRMYPPPLIEEPAFNVSYTRQPPNPGPGAQQPGPPYYTDPGGPGMNPVGNSMAMAFQV     71 - 140
PPNSPQGSVACPPPPAYCNTPPPPYEQVVKAK                                          141 - 172
//

Text Mined References (27)

PMID Year Title
25398664 2015 Epidermal growth factor receptor-coamplified and overexpressed protein (VOPP1) is a putative oncogene in gastric cancer.
23243056 2013 MiR-218 sensitizes glioma cells to apoptosis and inhibits tumorigenicity by regulating ECOP-mediated suppression of NF-?B activity.
21519330 2011 Loss of VOPP1 overexpression in squamous carcinoma cells induces apoptosis through oxidative cellular injury.
20571887 2010 Intracellular localization of GASP/ECOP/VOPP1.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19525979 2009 Combined genomic and gene expression microarray profiling identifies ECOP as an upregulated gene in squamous cell carcinomas independent of DNA amplification.
19505301 2009 Molecular signature of cell cycle exit induced in human T lymphoblasts by IL-2 withdrawal.
17515955 Molecular markers in patients with chronic wounds to guide surgical debridement.
16943533 2006 Increased epidermal growth factor receptor gene copy number is associated with poor prognosis in head and neck squamous cell carcinomas.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15735698 2005 ECop (EGFR-coamplified and overexpressed protein), a novel protein, regulates NF-kappaB transcriptional activity and associated apoptotic response in an IkappaBalpha-dependent manner.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11916499 2002 A chromosomal region 7p11.2 transcript map: its development and application to the study of EGFR amplicons in glioblastoma.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.