Property Summary

NCBI Gene PubMed Count 18
PubMed Score 32.17
PubTator Score 35.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis 1.200 4.8e-14
urothelial carcinoma -1.100 2.2e-03
uncontrolled asthma -1.100 2.2e-02
osteosarcoma -2.705 1.2e-02
tuberculosis 1.600 2.6e-05
non-small cell lung cancer -1.669 2.7e-11
intraductal papillary-mucinous adenoma (... -1.200 2.9e-02
lung cancer -3.700 1.2e-05
interstitial cystitis 1.800 8.6e-03
primary Sjogren syndrome 1.400 2.4e-03
lung adenocarcinoma -1.900 9.0e-10
lung carcinoma -2.700 1.9e-15
mucosa-associated lymphoid tissue lympho... 1.592 8.0e-03
ulcerative colitis 2.500 1.3e-05
ovarian cancer -1.200 6.3e-05

Gene RIF (7)

PMID Text
25465114 GPI-80 defines a subpopulation of human fetal liver hematopoietic stem/progenitor cells (HSPCs) with self-renewal ability.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17543284 analysis of structural divergence of GPI-80 in activated human neutrophils
14748512 some of the GPI-80 on pseudopodia of migrating neutrophils during the late phase was associated with urokinase-type plasminogen activator receptor (uPAR), a regulator of beta2 integrin-dependent adherence and migration
12967480 elevated GPI-80 expression is associated with development and progression of thymoma
12777063 GPI-80 positive monocytes belong to a monocyte subpopulation that is superior in phagocytosis and reactive oxygen production, but inferior in antigen presentation
12749849 DMSO induces neutrophil differentiation and provides suitable conditions for GPI-80 expression; this culture system is a model for the regulation of GPI-80 expression during myeloid differentiation.

AA Sequence

MVTSSFPISVAVFALITLQVGTQDSFIAAVYEHAVILPNKTETPVSQEDALNLMNENIDILETAIKQAAE      1 - 70
QGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHRFGHTPVQARLSCLAKDNSIYVLANL     71 - 140
GDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVARYHKYHLYSEPQFNVPEKPELVTFNTAFGRFGIFT    141 - 210
CFDIFFYDPGVTLVKDFHVDTILFPTAWMNVLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSGIY    211 - 280
APNGPKVYHYDMKTELGKLLLSEVDSHPLSSLAYPTAVNWNAYATTIKPFPVQKNTFRGFISRDGFNFTE    281 - 350
LFENAGNLTVCQKELCCHLSYRMLQKEENEVYVLGAFTGLHGRRRREYWQVCTLLKCKTTNLTTCGRPVE    351 - 420
TASTRFEMFSLSGTFGTEYVFPEVLLTEIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLY    421 - 490
SSCGTSNSAITYLLIFILLMIIALQNIVML                                            491 - 520
//

Text Mined References (20)

PMID Year Title
25465114 2015 GPI-80 defines self-renewal ability in hematopoietic stem cells during human development.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
19322213 2009 Expression of the vanin gene family in normal and inflamed human skin: induction by proinflammatory cytokines.
18805469 2008 Alternative spliced variants in the pantetheinase family of genes expressed in human neutrophils.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
17543284 2007 Structural divergence of GPI-80 in activated human neutrophils.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14748512 2003 GPI-80, a beta2 integrin associated glycosylphosphatidylinositol-anchored protein, concentrates on pseudopodia without association with beta2 integrin during neutrophil migration.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12967480 2003 Glycosylphosphatidyl inositol-anchored protein (GPI-80) gene expression is correlated with human thymoma stage.
12777063 2003 Localization of GPI-80, a beta2-integrin-associated glycosylphosphatidyl-inositol anchored protein, on strongly CD14-positive human monocytes.
12749849 2003 Expression of GPI-80, a beta2-integrin-associated glycosylphosphatidylinositol-anchored protein, requires neutrophil differentiation with dimethyl sulfoxide in HL-60 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056825 2002 Physical association of beta 2 integrin with GPI-80, a novel glycosylphosphatidylinositol-anchored protein with potential for regulating adhesion and migration.
11491533 Vanin genes are clustered (human 6q22-24 and mouse 10A2B1) and encode isoforms of pantetheinase ectoenzymes.
11200068 2001 Neutrophil secretory vesicles are the intracellular reservoir for GPI-80, a protein with adhesion-regulating potential.
10201959 1999 A novel glycosylphosphatidyl inositol-anchored protein on human leukocytes: a possible role for regulation of neutrophil adherence and migration.
9790769 1998 Two human genes related to murine vanin-1 are located on the long arm of human chromosome 6.