Property Summary

NCBI Gene PubMed Count 26
PubMed Score 245.37
PubTator Score 35.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.578 2.3e-04
psoriasis 1.800 7.5e-05
glioblastoma 2.500 1.2e-03
Duchenne muscular dystrophy 1.072 6.7e-06
juvenile dermatomyositis 1.438 1.1e-10
acute quadriplegic myopathy 1.858 3.4e-06
primary pancreatic ductal adenocarcinoma 1.150 8.1e-03
diabetes mellitus -1.200 1.1e-02
lung adenocarcinoma 1.281 7.9e-10
ductal carcinoma in situ 1.200 1.1e-02
invasive ductal carcinoma 1.800 4.2e-04
ovarian cancer 4.100 2.5e-07
pancreatic cancer 1.200 6.5e-03
dermatomyositis 1.500 2.2e-03

Gene RIF (16)

PMID Text
26328607 Study indicated that the expression of VMP1 was down-regulated and negatively correlated to the prognosis of colorectal cancer.
24365149 In colorectal cancer cells, VMP1-dependent autophagy appears to be pro-survival rather than pro-cell death.
23710913 in patients with invasive ductal carcinoma of the breast, Vmp1 expression had significant influence on disease-free survival time, with Vmp1-negative patients showing poor prognosis
23460482 These results underscore a novel role for VMP1 as a potential therapeutic target for combinatorial therapies aimed at sensitizing pancreatic cancer cells to chemotherapeutic agents
23316280 The VMP1-Beclin 1 interaction regulates autophagy induction.
22971212 upregulation of Vmp1 was associated with suppression of growth and pulmonary metastases of HCC.
22535956 AKT1-GLI3-VMP1 pathway mediates KRAS oncogene-induced autophagy in cancer cells.
22404213 Knockdown of vacuole membrane protein 1 (VMP1) by siRNA inhibits HIV-1 replication in CD4+/CCR5+/CXCR4+ TZM-bl HeLa cells
22333543 The expression of VMP1 had significant negative influence on the survival rate of non-small-cell lung cancer patients.
22144109 VMP1 is reduced by hypoxia, and down-regulation of VMP1 by miR-210 mediates hypoxia-induced HCC cell metastasis.
21467264 A fusion transcript (RPS6KB1-VMP1) recurrently expressed in 30% of breast cancers is associated with clinical consequences and may indicate genomic instability altering the expression of oncogenic components such as MIR21 and RPS6KB1.
21173155 Zymophagy, a novel selective autophagy pathway mediated by VMP1-USP9x-p62, prevents pancreatic cell death.
20299819 VMP1 knockdown decreased autophagy and apoptosis in gemcitabine-treated cancer cells
18550798 Vacuole membrane protein 1 is an endoplasmic reticulum protein required for organelle biogenesis, protein secretion, and development
17940279 VMP1 as a novel autophagy-related membrane protein involved in the initial steps of the mammalian cell autophagic process.
17724469 Endogenously expressed Vmp1 is essentially a cell membrane protein that is involved in cell-cell adhesion, invasion and metastasis.

AA Sequence

MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTS      1 - 70
KLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGP     71 - 140
HIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMAR    141 - 210
AARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGH    211 - 280
FLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLH    281 - 350
HKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK                  351 - 406
//

Text Mined References (30)

PMID Year Title
26328607 2015 Downregulation of VMP1 confers aggressive properties to colorectal cancer.
24365149 2014 VMP1 related autophagy and apoptosis in colorectal cancer cells: VMP1 regulates cell death.
23710913 2013 [Expression of vacuole membrane protein 1 and its prognostic value in invasive ductal carcinoma of the breast].
23460482 2013 Novel role of VMP1 as modifier of the pancreatic tumor cell response to chemotherapeutic drugs.
23316280 2013 The VMP1-Beclin 1 interaction regulates autophagy induction.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
22971212 2012 Novel roles of Vmp1: inhibition metastasis and proliferation of hepatocellular carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22535956 2012 Novel AKT1-GLI3-VMP1 pathway mediates KRAS oncogene-induced autophagy in cancer cells.
22333543 2011 [Expression and prognostic value of vacuole membrane protein 1 in non-small-cell lung cancer].
22144109 2011 Hypoxia-inducible microRNA-210 augments the metastatic potential of tumor cells by targeting vacuole membrane protein 1 in hepatocellular carcinoma.
21467264 2011 Transcriptional consequences of genomic structural aberrations in breast cancer.
21173155 2011 Zymophagy, a novel selective autophagy pathway mediated by VMP1-USP9x-p62, prevents pancreatic cell death.
20299819 2010 Gemcitabine induces the VMP1-mediated autophagy pathway to promote apoptotic death in human pancreatic cancer cells.
19056683 2009 The TP53INP2 protein is required for autophagy in mammalian cells.
18550798 2008 Vacuole membrane protein 1 is an endoplasmic reticulum protein required for organelle biogenesis, protein secretion, and development.
18384814 2008 miR-21 Gene expression triggered by AP-1 is sustained through a double-negative feedback mechanism.
17940279 2007 The pancreatitis-induced vacuole membrane protein 1 triggers autophagy in mammalian cells.
17724469 2008 Reduced expression of vacuole membrane protein 1 affects the invasion capacity of tumor cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466293 2004 High-content screening microscopy identifies novel proteins with a putative role in secretory membrane traffic.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11785947 2002 Cloning and expression of the rat vacuole membrane protein 1 (VMP1), a new gene activated in pancreas with acute pancreatitis, which promotes vacuole formation.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.