Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.07
PubTator Score 7.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric cancer 1.100 1.1e-03
hepatocellular carcinoma 1.200 2.0e-06
pancreatic cancer 1.100 4.4e-03
osteosarcoma 1.568 1.6e-03
Atopic dermatitis -1.100 7.0e-04
tuberculosis and treatment for 6 months -1.700 2.3e-04
group 4 medulloblastoma 1.200 1.8e-03
pancreatic carcinoma 1.100 4.4e-03
subependymal giant cell astrocytoma -1.674 2.4e-02
ductal carcinoma in situ -1.900 8.5e-04
invasive ductal carcinoma -1.700 6.4e-03
acute myeloid leukemia -1.600 4.2e-02

Gene RIF (6)

PMID Text
24532791 a concerted action of the four conserved cysteines of VKORC1L1 for active site regeneration
23928358 The involvement of VKORC1L1 in VKOR activity partly explains the low susceptibility of some extrahepatic tissues to vitamin K antagonists.
21367861 VKORC1L1 is responsible for driving vitamin K-mediated intracellular antioxidation pathways critical to cell survival.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17996924 VKORC1L1 does not affect the variability of warfarin dose requirement in a Japanese patient population
14765194 molecular cloning

AA Sequence

MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSAALASRWGRGF      1 - 70
GLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMSVVGSLYLAYILYFVLKEFCI     71 - 140
ICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD                                      141 - 176
//

Text Mined References (21)

PMID Year Title
26772871 2016 The membrane topology of vitamin K epoxide reductase is conserved between human isoforms and the bacterial enzyme.
26264021 2015 VKORC1 and VKORC1L1: Why do Vertebrates Have Two Vitamin K 2,3-Epoxide Reductases?
26230708 2015 Phylogeny of the Vitamin K 2,3-Epoxide Reductase (VKOR) Family and Evolutionary Relationship to the Disulfide Bond Formation Protein B (DsbB) Family.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24532791 2014 Conserved loop cysteines of vitamin K epoxide reductase complex subunit 1-like 1 (VKORC1L1) are involved in its active site regeneration.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23928358 2013 VKORC1L1, an enzyme rescuing the vitamin K 2,3-epoxide reductase activity in some extrahepatic tissues during anticoagulation therapy.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21367861 2011 Human vitamin K 2,3-epoxide reductase complex subunit 1-like 1 (VKORC1L1) mediates vitamin K-dependent intracellular antioxidant function.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17996924 2008 No association between vitamin K epoxide reductase complex subunit 1-like 1 (VKORC1L1) and the variability of warfarin dose requirement in a Japanese patient population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14765194 2004 Mutations in VKORC1 cause warfarin resistance and multiple coagulation factor deficiency type 2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.