Property Summary

NCBI Gene PubMed Count 64
PubMed Score 136.46
PubTator Score 99.26

Knowledge Summary

Patent (16,353)

Expression

 GWAS Trait (1)

Gene RIF (37)

PMID Text
26881970 The results reveal that more severe inflammation, based on high levels of IL-6, is associated with lower expression of VPAC1 and, conversely, with increased expression of VPAC2.
26304033 Lower CpG methylation of VIPR2 in the saliva of children with ADHD.
24827637 Monocytes from Sjogren's syndrome patients display increased vasoactive intestinal peptide receptor 2 expression and impaired apoptotic cell phagocytosis.
24794882 This study suggest that carriers of microduplication genotypes of VIPR2 are predisposed to SCZ in Han Chinese.
24469917 CD4+ T cells in HIV infection show increased levels of expression of VPAC2
23818986 Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1.
23637909 This is the first study to suggest a role of VIPR2 in the genetic susceptibility to high myopia. EGR1, JUN, FOS and VIP are unlikely to be important in predisposing humans to high myopia.
23073313 Genetic testing for VIPR2-LCR-associated inversions should be performed on available cohorts of psychiatric patients to evaluate their potential pathogenic role
22961270 Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans.
22886412 PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats.
22763881 The overexpression of VPAC1 and VPAC2 receptors and COX-2 in cancer tissue gives them a potential role as targets for diagnosis of prostate cancer.
21769421 mRNA expression of the VPAC1 receptor was detected in 51% of the tumor specimens, while the incidence of mRNA expression for VPAC2 was 46%.
21721910 gene expression level and cAMP signaling of VIPR2 were increased in patients carrying 7q36.3 microduplications, thus implicating VIPR2 in the etiology of schizophrenia.[review]
21711977 increased expression in patients with allergic rhinitis
20691743 VPAC(2) receptor presents an extranuclear localization and its protein expression is lower than that of VPAC(1) receptor in human breast tissue samples
20554694 Observational study of gene-disease association. (HuGE Navigator)
20395540 VPAC2 and/or PAC1 receptor activation is involved in cutaneous active vasodilation in humans.
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20180986 Observational study of gene-disease association. (HuGE Navigator)
20072116 Observational study of gene-disease association. (HuGE Navigator)
20026142 Results indicate that VPAC1, but not VPAC2 or PAC1, up-regulation in macrophages is a common mechanism in response to acute and chronic pro-inflammatory stimuli.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19470168 Observational study of gene-disease association. (HuGE Navigator)
19269029 a novel mechanism of calmodulin in regulating PACAP signaling by possible interaction with the inactive state of PAC1 and VPAC2 receptors.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18383383 VIP(Vasoactive intestinal peptide) expression was decreased in Rhematoid Arthritis (RA) synovial fibroblasts (FLS) compared with Osteoarthritis(OA) FLS;in RA FLS, VPAC2 (VIP receptor type 2) mediates the antiinflammatory effects of VIP
17883247 analysis of VIP 16gamma-glutamyl diamino derivative positive charges on hVPAC1 and hVPAC2 receptor function
17257640 Daily stimulation of VPAC2, but not VPAC1 or PAC1, resulted in up to 90% inhibition of X4 or R5 productive infections in either cell lines or PBMCs.
17077178 altered expression of VPAC2 in activated CD4+ T cells derived from multiple sclerosis (MS) patients rendered CD4+ T cells less responsive to VIP and skewed the system to a predominantly T(h)1 direction.
16934434 identification and characterization of novel five-transmembrane(5TM) isoforms of VPAC2
16888203 splice variants may modify the immunoregulatory contributions of the VIP-VPAC2 axis
16572459 VPAC2-R mRNA was visualized only in the cerebellum of 7-22-year-old subjects.
16552823 The abnormal expression of VPCAP2-R mRNA in gallbladder tissue may play a role in the formation of gallbladder stones and gallbladder polyps
16500728 a novel recombinant agonist for VPAC2 is not active against PAC1
15302876 analysis of a mutant form of VPAC2 shows its role in signaling and ligand binding
15090046 Detection of beta-galactosidase marker for human VPAC2/VIPR2 in cells withinin the suprachiasmatic nucleus (SCN) of transgenic mice indicates that VPAC2 may contribute to autoregulation and/or coupling within the SCN core and to control of the SCN shell.

AA Sequence

MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGET      1 - 70
VTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMS     71 - 140
LATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQ    141 - 210
YCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVP    211 - 280
WWVIRIPILISIIVNFVLFISIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS    281 - 350
ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ    351 - 420
FHRGSRAQSFLQTETSVI                                                        421 - 438
//

Text Mined References (67)

PMID Year Title
26881970 2016 Clinical Relevance of VPAC1 Receptor Expression in Early Arthritis: Association with IL-6 and Disease Activity.
26304033 2016 Methylomic analysis of salivary DNA in childhood ADHD identifies altered DNA methylation in VIPR2.
24827637 2014 Monocytes from Sjögren's syndrome patients display increased vasoactive intestinal peptide receptor 2 expression and impaired apoptotic cell phagocytosis.
24794882 2014 A competitive PCR assay confirms the association of a copy number variation in the VIPR2 gene with schizophrenia in Han Chinese.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24469917 2014 CD4+ T cells in HIV infection show increased levels of expression of a receptor for vasoactive intestinal peptide, VPAC2.
23818986 2013 Macrophage Resistance to HIV-1 Infection Is Enhanced by the Neuropeptides VIP and PACAP.
23637909 2013 Genetic susceptibility to refractive error: association of vasoactive intestinal peptide receptor 2 (VIPR2) with high myopia in Chinese.
23406873 2013 A genome-wide meta-analysis identifies two novel loci associated with high myopia in the Han Chinese population.
23073313 2013 Low-copy repeats at the human VIPR2 gene predispose to recurrent and nonrecurrent rearrangements.
22961270 2012 Nitric oxide and receptors for VIP and PACAP in cutaneous active vasodilation during heat stress in humans.
22886412 2012 PACAP causes PAC1/VPAC2 receptor mediated hypertension and sympathoexcitation in normal and hypertensive rats.
22763881 2012 Overexpression of vasoactive intestinal peptide receptors and cyclooxygenase-2 in human prostate cancer. Analysis of potential prognostic relevance.
21769421 2011 Gene expression of vasoactive intestinal peptide receptors in human lung cancer.
21721910 2011 Genome-wide investigation of rare structural variants identifies VIPR2 as a new candidate gene for schizophrenia.
21711977 Alterations of vasoactive intestinal polypeptide receptors in allergic rhinitis.
21346763 2011 Duplications of the neuropeptide receptor gene VIPR2 confer significant risk for schizophrenia.
20691743 2010 Nuclear localization of vasoactive intestinal peptide (VIP) receptors in human breast cancer.
20554694 Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
20395540 2010 VIP/PACAP receptor mediation of cutaneous active vasodilation during heat stress in humans.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20180986 2010 CLOCK is suggested to associate with comorbid alcohol use and depressive disorders.
20072116 2010 Differential association of circadian genes with mood disorders: CRY1 and NPAS2 are associated with unipolar major depression and CLOCK and VIP with bipolar disorder.
20026142 2010 Vasoactive intestinal peptide (VIP) receptor expression in monocyte-derived macrophages from COPD patients.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19470168 2009 NPAS2 and PER2 are linked to risk factors of the metabolic syndrome.
19269029 2009 Calmodulin interacts with PAC1 and VPAC2 receptors and regulates PACAP-induced FOS expression in human neuroblastoma cells.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18383383 2008 Differential expression of vasoactive intestinal peptide and its functional receptors in human osteoarthritic and rheumatoid synovial fibroblasts.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17883247 2008 Effect of positive charge in VIP 16gamma-glutamyl diamino derivatives on hVPAC1 and hVPAC2 receptor function.
17257640 2007 HIV-1 integration is inhibited by stimulation of the VPAC2 neuroendocrine receptor.
17077178 2006 Altered expression of vasoactive intestinal peptide receptors in T lymphocytes and aberrant Th1 immunity in multiple sclerosis.
16934434 2006 Identification and characterization of five-transmembrane isoforms of human vasoactive intestinal peptide and pituitary adenylate cyclase-activating polypeptide receptors.
16888203 2006 Functional splice variants of the type II G protein-coupled receptor (VPAC2) for vasoactive intestinal peptide in mouse and human lymphocytes.
16572459 2006 Localization and characterization of pituitary adenylate cyclase-activating polypeptide receptors in the human cerebellum during development.
16552823 2006 Expression of pituitary adenylate cyclase-activating polypeptide 1 and 2 receptor mRNA in gallbladder tissue of patients with gallstone or gallbladder polyps.
16500728 2006 Intein-mediated rapid purification and characterization of a novel recombinant agonist for VPAC2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302876 2004 A natural variant type II G protein-coupled receptor for vasoactive intestinal peptide with altered function.
15090046 2004 Transgenic approach reveals expression of the VPAC2 receptor in phenotypically defined neurons in the mouse suprachiasmatic nucleus and in its efferent target sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12150135 2002 Simultaneous detection of receptor mRNA and ligand protein in human skin tissues.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11728828 2001 Neuroendocrine differentiation of the LNCaP prostate cancer cell line maintains the expression and function of VIP and PACAP receptors.
11351046 2001 Expression and distribution of vasoactive intestinal polypeptide receptor VPAC(2) mRNA in human airways.
11193874 2000 Vasoactive intestinal peptide (VIP) receptor type 2 (VPAC2) is the predominant receptor expressed in human thymocytes.
11160313 2001 Selective gene expression and activation-dependent regulation of vasoactive intestinal peptide receptor type 1 and type 2 in human T cells.
11072126 2000 Expression of vasoactive intestinal peptide (VIP) receptors in human uterus.
10801840 2000 Identification of key residues for interaction of vasoactive intestinal peptide with human VPAC1 and VPAC2 receptors and development of a highly selective VPAC1 receptor agonist. Alanine scanning and molecular modeling of the peptide.
10764955 2000 Immunohistochemical localization and distribution of VIP/PACAP receptors in human lung.
10481065 1999 Structure of the human VIPR2 gene for vasoactive intestinal peptide receptor type 2.
9629281 1998 Selectivity of effects of vasoactive intestinal peptide on macrophages and lymphocytes in compartmental immune responses.
9541464 1998 The vasoactive intestinal peptide analogue RO25-1553 inhibits the production of TNF and IL-12 by LPS-activated monocytes.
9454823 1998 Site-directed mutagenesis of human vasoactive intestinal peptide receptor subtypes VIP1 and VIP2: evidence for difference in the structure-function relationship.
8938447 1996 Chromosomal localization in mouse and human of the vasoactive intestinal peptide receptor type 2 gene: a possible contributor to the holoprosencephaly 3 phenotype.
8933357 1996 Tissue specific expression of different human receptor types for pituitary adenylate cyclase activating polypeptide and vasoactive intestinal polypeptide: implications for their role in human physiology.
8926282 1996 Predominant expression of type II vasoactive intestinal peptide receptors by human T lymphoblastoma cells: transduction of both Ca2+ and cyclic AMP signals.
8757618 1996 Transduction of specific inhibition of HuT 78 human T cell chemotaxis by type I vasoactive intestinal peptide receptors.
8146174 1994 Cloning and functional characterization of a third pituitary adenylate cyclase-activating polypeptide receptor subtype expressed in insulin-secreting cells.
7811244 1994 Molecular cloning and functional characterization of a human VIP receptor from SUP-T1 lymphoblasts.
7733904 1995 Cloning and functional characterization of the human vasoactive intestinal peptide (VIP)-2 receptor.