Property Summary

NCBI Gene PubMed Count 340
PubMed Score 1676.88
PubTator Score 6424.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cataract 104 0.0 4.0
Disease Target Count
Cataract 30 1
cataract 2 multiple types 9

Expression

Protein-protein Interaction (12)

Gene RIF (280)

PMID Text
27069130 Vimentin Regulates Invasiveness and Is a Poor Prognostic Marker in Non-small Cell Lung Cancer
27048119 TWIST2 regulates epithelial-mesenchymal transition by depriving the epithelial cell phenotype of E-cadherin and endowing the mesenchymal cell phenotype with Vimentin, which may be involved in the progression and prognosis of ovarian cancer.
26708270 The present study therefore indicated that IL-6 promoted the process of EMT in HIBECs as characterized by increased migration and invasion of HIBECs and the typical changes in mRNA and protein expression of the EMT markers E-cadherin and vimentin.
26702618 These data suggest that the number of polyploid giant cancer cells and the EMT-related proteins E-cadherin, N-cadherin, and vimentin may be valuable biomarkers to assess metastasis in patients with breast cancer.
26646105 High vimentin and low beta4 integrin protein levels are associated with poor survival in oral squamous carcinoma patients.
26617803 PTTG2 induces psoriasis by regulating epidermal expression of vimentin and E-cadherin.
26567912 Low aggressive MCF-7 breast cancer cells have low endogenous PLD enzymatic activity and cell invasion, concomitant with high expression of miR-203, -887, and -3619 and miR-182 and miR-182.
26499837 Data show that over-expression of vimentin ameliorated cytotoxicity of gambogic acid (GA) in HeLa cells.
26466680 On the basis of these results, we propose a model in which dynamic vimentin filaments target CARMIL2 to critical membrane-associated locations, where CARMIL2 regulates CP, and thus actin assembly, to create cell protrusions
26180933 immunohistochemical pattern helps to differentiate cystic renal oncocytoma from tubulocystic renal cell carcinoma
26168186 Studied the link between VEGFR-1 and PKG-1 in copper regression of cardiomyocyte hypertrophy.
26161965 Data suggest that tubulin functionally interact with the vimentin network in a cell-type specific manner.
26160837 AOC4P lncRNA acts as a hepatocellular carcinoma tumor suppressor by enhancing vimentin degradation and suppressing the epithelial-mesenchymal transition
26149185 Data show that peptidylarginine deiminase type 4, mutated citrullinated vimentin and cyclic citrullinated peptides autoantibodies were detected in 24, 61 and 74% of rheumatoid arthritis (RA) patients, respectively.
26109569 Data show that vimentin subunit exchange in vimentin intermediate filaments (VIFs) precursors called unit-length filaments (ULFs) depends on ATP.
26045832 E-cadherin and vimentin positive expression was associated with tumor metastasis of oral squamous cell carcinoma
26031447 Cys328, through its interaction with Zn, is essential for vimentin network reorganization in response to oxidants and electrophiles, and is required for vimentin performance in network expansion, lysosomal distribution and aggresome formation.
25904701 VIM mRNA is the best predictive parameter of renal fibrosis compared with estimated glomerular filtration rate, serum creatinine, and blood urea nitrogen
25902909 Hypermethylation of vimentin promoter is increased in inflamed colon tissue.
25855378 Consistent with its role as an intermediate filament, vimentin acted as a scaffold to recruit Slug to ERK and promote Slug phosphorylation at serine-87.
25826487 vimentin and FSP1 have roles in gingival fibrosis
25820701 Univariate analyses indicated that the T stage, lymph node metastasis, the TNM stage, and the expression of claudin-3, beta-catenin, and vimentin were significant predictors for overall survival (OS).
25736925 C6orf106 promotes invasion in NSCLC cells. Finally, C6orf106 upregulates vimentin, and downregulates E-cadherin and P120ctn.
25717187 vimentin filaments are very dynamic and that their transport is required for filament network maintenance.
25588502 Data suggest MAP kinase-interacting kinases (Mnk1, Mnk2) regulate cell migration/wound healing, expression of VIM, stability of VIM, and binding of eIF4E (eukaryotic translation initiation factor 4E)/CYFIP1 (cytoplasmic FMR1 interacting protein 1).
25548991 Immunohistochemical staining for vimentin and actin was not able to differentiate between spitz nevi and spitzoid malignant melanomas.
25536665 ALP mRNA binds to and is stabilized by vimentin.
25487874 Findings indicate that Cell-surface Vimentin csVimentin(+) CD133(-) cells are promising targets for treatment and prevention of metastatic hepatocellular carcinoma.
25362514 high expression in hepatocellular carcinoma
25329121 This study focused on analyzing the immunoexpression of CK19, vimentin and E-cadherin in a number of 43 differentiated thyroid carcinomas.
25322343 Vimentin expression profile in melanoma
25306868 Vimentin, an antigenic feature of inflammation, is a dominant autoantigen targeted in situ in lupus nephritis (LN) tubulointerstitial inflammation (TII). This adaptive autoimmune response likely feeds forward to worsen TII and renal damage.
25288153 HtrA2 under stress conditions induces vimentin cleavage in wild-type and SH-SY5Y cells transfected with APP with the Alzheimer disease-associated Swedish mutation. Interplay between Omi/HtrA2 and vimentin affects mitochondrial distribution in neurons.
25282138 In this cohort of NPC patients, higher levels of E-cadherin and higher levels of vimentin were associated with worse outcomes
25278713 Vimentin methylation status can predict the prognosis of pancreatic cancer patients.
25211928 an association between the vimentin and ki-67 expression levels and the degree of spread of metastatic renal cell carcinoma was identified: the high level of expression of these markers precludes the increase of life expectancy
25189876 Mutated and citrullinated vimentin autoantigenic epitopes were emulated by cyclic citrullinated MCV-derived peptides and recognised by all autoantibody-Ig subclasses in RA.
25187410 VIM was verified to be related to HAART treatment and viral load in HIV infections.
25120060 Syndecan-1 is involved in morphogenesis of the developing tooth crown and cervical loops, andntogether with CK8 and vimentin in differentiation of preameloblasts and preodontoblasts.
25075038 VIM methylation of serum DNA may be a useful marker for the early detection of colorectal cancer
25028191 vimentin, survivin and p53 may have a role in clear cell renal cell carcinoma
25001935 Data indicate tha up-regulation of vimentin could promote the invasion of SW780 cells.
24978037 The production of IgG antivimentin antibodies by a minority of interstitial fibrosis and tubular atrophy patients suggests that in some individuals, IgG AVA may be involved in the pathology of IFTA.
24954475 knockdown of miR-378a increased the expression of its target proteins, vimentin, and beta3 integrin, which accelerated fibroblast migration and differentiation in vitro and enhanced wound healing in vivo.
24942637 The VIM gene is frequently methylated in cervical squamous cell carcinoma and that its methylation might predict a favorable prognosis.
24858039 Authors propose a model whereby vimentin promotes FAK stabilization through VAV2-mediated Rac1 activation. This model may explain why vimentin expressing metastatic lung cancer cells are more motile and invasive.
24850148 PADI2 and vimentin participate in the apoptotic mechanisms of activated T lymphocytes.
24843142 We demonstrate, using long-term 4D imaging, that the vimentin intermediate filament establishes mitotic polarity in mammalian cell lines and mediates the asymmetric partitioning of damaged proteins.
24792370 results confirm that charged amino acids are essential for antibody reactivity and that the vimentin antibody is dependent on side-chain interactions in combination with backbone interactions
24781336 High S100A4 and vimentin protein expression correlate with an aggressive, malignant phenotype in hepatocellular carcinoma.
24737666 Vimentin was up-regulated after ultraviolet exposure in human dermal microvascular endothelial cells. On the other hand, it was down-regulated after intense pulsed light exposure.
24736615 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
24729088 The findings of our meta-analysis confirm that vimentin methylation may play a crucial role in the pathogenesis of CRC
24681739 Ovarian and uterine corpus endometrioid adenocarcinomas have different patterns of vimentin expression.
24657653 NOR1 suppresses slug/vimentin expression to inhibit epithelial-mesenchymal transformation in nasopharyngeal carcinoma.
24652946 The microtubule-dependent transport of vimentin ULFs is further regulated by Rho-kinase.
24642750 platelet vimentin engages VWF during platelet adhesion under high shear stress
24623428 Authors reported that enterovirus 71 VP1 protein could bind to vimentin intermediate filaments expressed on the host cell surface.
24612689 In the doxorubicin resistant MCF-7 cells, high levels of vimentin expression were observed.
24505633 WeThis study investigated sections of human polycystic ovarian tissue for vimentin and a set of cytokeratins by epifluorescence.The studied proteins showed strong colocalization.
24474778 data are consistent with the possibility that oncogenes can induce cellular stiffness via an HDAC6-induced reorganization of the vimentin intermediate filament network
24447545 RUNX3 suppressed gastric cancer cell invasion and vimentin expression by activating miR-30a.
24387004 This review discusses various novel functions which are now known to be mediated by vimentin, summarizing structure, regulation and roles of vimentin in cell adhesion, migration, angiogenesis, neurite extension, and cancer.
24284321 Cellular vimentin regulates construction of dengue virus replication complexes through interaction with NS4A protein.
24196446 Phosphoproteomic analysis revealed that Plk1 phosphorylates the intermediate filament protein vimentin on Ser459, which is dispensable for its filament formation but is necessary for the inhibition of endocytic vesicle fusion in mitosis
24173714 In the mechanical environment in vivo, vimentin is more dynamic than previously reported.
24139214 P-cadherin and vimentin could be adjunctive to the commonly used immunohistochemical surrogates for basal-like breast cancer identification.
24075276 Epithelial-to-mesenchymal transition statuses of patients are determined by calculating the ratio of vimentin to E-cadherin, whereby patients are categorized into 3 groups: epithelial, intermediate, and mesenchymal.
24061457 Increased vimentin expression is associated with bad prognostic factors in infiltrating ductal carcinoma of the breast
24005669 proangiogenic signals converge to enhance expression and association of RACK1 and vimentin, which regulated FAK, resulting in successful endothelial sprout formation in three-dimensional collagen matrices.
24001454 Increased expression of vimentin is associated with lymph node metastasis in colorectal cancer.
23991044 Data indicate that E-cadherin was elevated , and the expression levels of N-cadherin, Vimentin and Twist1 were all decreased in oleanolic acid (OA)-treated cells.
23974215 Vimentin is a phosphorylation target of PKC-beta in MCP-1-treated monocytes and that PKC-beta phosphorylation is essential for vimentin secretion.
23885566 involvement of vimentin in migration processes at different stages of development and try to resolve current contradictions concerning the role of vimentin in various events of cell migration
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
23873106 Data show that miR-148a downregulated vimentin expression and upregulated E-cadherin expression, suggesting that miR-148a inhibited epithelial-mesenchymal transition (EMT), and the SMAD2 gene was identified as the direct and functional target of miR-148a.
23831462 Changes in vimentin, lamin A/C and mitofilin expression induce aberrant cell organization in fibroblasts from Fanconi anemia complementation group A (FA-A) patients.
23824807 This study identifies PKCalpha, PKCepsilon, and vimentin as key factors affecting efficient infection and transduction by echovirus 1 and baculovirus, respectively.
23785295 vimentin expression was sufficient to induce increased mesenchymal/pro-metastasic phenotypic changes in melanoma cells
23773638 Serum anti-mutated citrullinated vimentin autoantibodies are useful for the diagnosis of rheumatoid arthritis in Chinese patients.
23751022 Vimentin expression in epithelial cells of the surgically resected gastric adenocarcinoma tissue is an independent predictor of short survival, and Her-2 status shows a valuable correlation with clinical parameters.
23717685 this study is the first to demonstrate that up-regulation of vimentin and plectin expression positively correlates with the invasion and metastasis of androgen-independent PCA
23682784 Phenethyl isothiocyanate treatment caused induction of vimentin protein expression in human cancer cells.
23677639 Data indicate that pancreatic (pro)enzymes enhanced expression of beta-catenin and E-cadherin and decreased expression of several epithelial-mesenchymal transition (EMT)-associated genes, such as Vimentin, Snail and Slug.
23674515 Vimentin is an endogenous, activating ligand for Dectin-1. Its presence in areas of artery wall inflammation and O production suggests that vimentin activates Dectin-1 and contributes to lipid oxidation and cholesterol accumulation in atherosclerosis.
23663103 streptococcal-vimentin cross-reactive antibodies were able to activate microvascular cardiac endothelium by amplifying the inflammatory response in RHD.
23614934 In patients with breast cancer neoplasm grade and expression of BRCA1, Lys27H3, vimentin, and KI67 can be used to predict BRCA1 germline mutations.
23576498 interaction between FMDV 2C and cellular vimentin is essential for virus replication.
23562674 Vimentin expression predicts the occurrence of metastases in non small cell lung carcinomas.
23504025 Data show that TGF-beta1 regulates E-cadherin and vimentin expression through KLF8 pathway.
23482564 an association between vimentin, hGIIA, and arachidonic acid metabolism in synovial inflammation.
23418554 Data suggest that multi-antibody assay of TTF1, Vimentin, p63 CD56, chromogranin and synaptophysin may be of special value, especially in diagnosing small biopsies.
23418544 Data indicate that five important proteins, vimentin, gelsolin, alpha 2 HS glycoprotein (AHSG), glial fibrillary acidic protein (GFAP), and alpha1B-glycoprotein (A1BG) were expressed higher in Rheumatoid arthritis (RA) synovial fluid than non-RA samples.
23412770 Vimentin, zeb1 and Sip1 are up-regulated in triple-negative and basal-like breast cancers: association with an aggressive tumour phenotype.
23357686 Vimentin is one of the trans-acting factors that contribute to the regulation hHRI gene expression.
23354842 The elevated expression of vimentin contributes to the aggressive phenotype and poor prognosis in TNBC. Vimentin expression might be useful as a biomarker for the prognosis of TNBC.
23295955 Data indicate that the reduced vimentin expression in response to EPHB4, WIPF2 and MTHFD2 silencing was observed at mRNA and protein levels.
23292832 soft tissue leiomyosarcoma patients with the gain of E-cadherin and loss of Vimentin expression represent favorable trend of
23291835 Data indicate that the nestin and vimentin dots were random distributed within filamentous lines tens of nanometers to one hundred nanometers thick.
23280360 Degraded citrullinated vimentin (VICM) was greater in rheumatoid arthritis and ankylosing spondylitis patients than in healthy controls. VICM levels correlated with disease burden in AS, and were significantly associated with radiographic progression.
23239149 Vimentin methylation predicted poor overall survival independent of race, subtype, stage, nodal status, or metastatic disease in breast cancer patients.
23224145 TWF1 and VIM are required for miR-30c to regulate breast cancer cell invasion.
23221510 The data showed that both fascin and vimentin proteins were significantly overexpressed in cholangiocarcinoma, whereas E-cadherin expression was reduced in cholangiocarcinoma compared with normal tissues.
23135265 miR-378 is a regulator of stem cell marker Sox2 by targeting vimentin
23125841 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
23072594 These results suggest the presence in melanoma of growth mechanisms involving nestin, vimentin, and the glucocorticoid receptor may help in understanding tumour biology to provide a molecular basis for clinical therapies.
23056278 Methylation levels of EOMES, HOXA9, POU4F2, TWIST1, VIM, and ZNF154 in urine specimens are promising diagnostic biomarkers for bladder cancer recurrence surveillance
23049725 Loss of SARI expression initiates epithelial-to-mesenchymal transition (EMT), which is visualized by repression of E-cadherin and up-regulation of vimentin in lung adenocarcinoma cell lines and in clinical lung adenocarcinoma specimens.
22971934 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
22929228 we propose a novel regulatory mechanism of IP3R1 activity by type III intermediate filament vimentin
22886823 High Slug and low E-cadherin expression in basal-like breast cancer (BLBC) correlated with histological grade, TNM stage, and lymphatic metastasis. Poor prognosis of BLBC is associated high Slug and vimentin expression and low E-cadherin levels.
22879973 This study suggests that vimentin binds the ALOX15 promoter and regulates its promoter activity and protein expression
22869704 analysis of atomic structure of the vimentin central alpha-helical domain and its implications for intermediate filament assembly
22766839 data suggest vimentin may function as an oncogene and is regulated by tumor suppressive miR138; existence of a tumor suppressive miR138-mediated oncogenic pathway provides new insights into the potential mechanisms of renal cell carcinoma oncogenesis and metastasis
22763828 PCNA expression was decreased but ICAM-1 expression was significantly increased in the NIDDM and cataract group compared with that of non-diabetic cataract patients; vimentin was unchanged
22759266 The authors conclude that host cell tropism, which may depend on the host protein vimentin, is relevant for Propionibacterium acnes invasion and in part determines its sustained inflammatory capacity and persistence of infection.
22740688 The structure of vimentin linker 1 and rod 1B domains characterized by site-directed spin-labeling electron paramagnetic resonance (SDSL-EPR) and X-ray crystallography.
22730818 Vimentin is expressed in lamina propria and epithelium of both normal nasal mucosa and chronic rhinosinusitis.
22704062 Trends in the expression of Vimentin suggests its involvement in oral carcinogenesis via Wnt pathway dysregulation.
22684479 Vimentin is an important regulator of NOD2 function and a potential novel therapeutic target in the treatment of Crohn disease (CD).
22659602 A significantly increased heterogeneity of gene expression for vimentin is demonstrated in osteoarthritic chondrocytes.
22644514 High expression of vimentin is associated with esophageal squamous cell carcinoma.
22584948 Vimentin levels were unchanged in PLA-resistant R1 cells.
22535769 vimentin ablation results in defective steroidogenesis
22476851 miR-30a downmodulates vimentin expression might provide a therapeutic target for the treatment of breast cancer.
22407449 pro-angiogenic signals converge to activate calpain-dependent vimentin cleavage and increase vimentin solubility, which act upstream to facilitate MT1-MMP membrane translocation
22395512 analysis of CD105, CD31, alpha-SMA, vimentin and desmin expression on a series of normal human heart tissues varying between five and 33 weeks
22367194 MT6-MMP regulates neutrophil and monocyte chemotaxis and by generating "eat-me" signals upon vimentin cleavage potentially increases phagocytic removal of neutrophils to resolve inflammation.
22345628 The results suggest a common mechanism for the clearance of apoptotic cells, through the interaction of surface vimentin with O-GlcNAc-modified proteins.
22340393 Tumor vimentin level may reflect the pathological progression in some gallbladder carcinoma and may be a useful marker for predicting tumor metastasis.
22315367 Aberrant vimentin methylation is associated with upper gastrointestinal neoplasms.
22307379 High nuclear vimentin expression correlated significantly with positive lymph node metastasis in nasopharyngeal carcinoma
22251609 Hypermethylated vimentin in urine is associated with colorectal cancer.
22236966 Data show that vimentin is a novel target for HIPK2 repressor function and that HIPK2-mediated vimentin downregulation can contribute to inhibition of breast cancer cells invasion.
22221700 The combination of a decrease of E-cadherin and an increase in vimentin might be a valuable survival indictor in cervical squamous cell cancer.
22216242 data suggest that vimentin provides a specific binding site for soluble CD44 on endothelial cells
22022619 Immunohistochemical analysis on a malignant mesothelioma tissue microarray showed cytoplasmic staining in 28 of 33 samples for vimentin and strong cytoplasmic staining in14 and weak in 16 samples for ss-F1-ATPase.
21914078 Hepatitis C virus nonstructural (NS) 3 and NS5A proteins were associated with filamin A, while core protein partially with filamin A and vimentin.
21803859 TGFbeta1-mediated vimentin protein expression, cell migration, and wound closure are prevented by a pharmacological inhibitor of the Smad pathway and by expression of Ad-shRNA against vimentin.
21803052 Endothelial cell surface vimentin binding peptide induces angiogenesis under hypoxic/ischemic conditions.
21769486 HLA-DR9 alleles could exert a protective effect on the recognition of citrullinated vimentin epitopes by CD4+ T cells in rheumatoid arthritis.
21746880 study reports that vimentin filaments associate with collagen mRNAs in a 5'stem-loop sequence and LARP6-dependent manner and stabilize collagen mRNAs
21664858 In the current study of patients with tongue cancer, decreased E-cadherin and increased vimentin were found in spreading tumor satellites
21515330 We confirmed the decreased capacity of cell migration due to down-regulation of vimentin by apigenin.
21508377 Aberrant methylation of the Vimentin gene is associated with hepatocellular carcinoma.
21491466 MBD1-containing chromatin associated factor 2, epithelial malignancy-related vimentin and exocytosis-related annexin A2 were changed upon exposure to airborne nanoparticle PM(0.056).
21465480 These findings demonstrate the distinct involvement of Cdk5 in GTP- and fMLP-induced secretion by neutrophils, and support the notion that specific targeting of Cdk5 may serve to inhibit the neutrophil secretory process.
21448168 The presence of vimentin-expressing tumour epithelial cells in surgically resected pancreatic adenocarcinomas independently predicted a shorter postsurgical survival.
21442485 There was a positive correlation between STAT3 and vimentin expression and a negative correlation between STAT3 and E-cadherin in colon cancer.
21346197 When vimentin organization is disrupted by a dominant-negative mutant or by silencing, there is a loss of polarity. These findings demonstrate an antagonistic relationship between vimentin intermediate filaments (VIF) and the formation of lamellipodia.
21327330 Vimentin mRNA expression is associated with recurrence or distant metastasis and decreased survival in gastric cancer.
21317457 Identification of vimentin (vimentin354), a nuclear component in glioblastoma multiforme cells, as the main target of sumoylation promoted by PIAS3.
21217813 eEF1gamma, in addition to its role in translation elongation complex, is involved in regulating Vimentin gene by contacting both pol II and the Vimentin promoter region and shuttling/nursing the Vimentin mRNA
21199468 Report the diagnostic value of autoantibodies directed against citrullinated vimentin in diagnosing rheumatoid arthritis.
21187483 Of 44 colorectal cancer patients, 4 (9%) exhibited methylation of the vimentin gene in their serum DNA by qMSP.
21094801 Vimentin expression and myofibroblast infiltration are early markers of renal dysfunction in kidney transplantation.
21057535 vimentin functionally contributes to EMT and is required for induction of Axl expression.
20975101 GDF15, HSPA2, TMEFF2, and VIM were identified as epigenetic biomarkers for Bladder cancer.
20856200 AKT1 activation induces soft-tissue sarcoma cell motility and invasiveness at least partially through a novel interaction with the intermediate filament vimentin
20729920 TRIM16 acts as a tumour suppressor, affecting neuritic differentiation, cell migration and replication through interactions with cytoplasmic vimentin and nuclear E2F1 in neuroblastoma cells.
20701774 High vimentin is associated with melanoma hematogenous metastasis.
20651380 Vimentin-positive expression correlates with dedifferentiation and predicts poor survival in patients undergoing resection for intrahepatic cholangiocarcinoma (ICC).
20609218 citrullinated vimentin could play an important role in the pathogenesis of rheumatoid arthritis
20602472 Vimentin contributes to changes in chondrocyte stiffness in osteoarthritis.
20588206 Kidney tranplantation vimentin expression correlates with long term kidney function and intertitial fibrosis and tubular trophy.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20447406 investigate the elastic properties of networks formed by a series of protein variants with stepwise tail truncations and find that the last 11 amino acids of the C-terminal tail domain mediate crosslinking by divalent ions
20422486 JAK2/STAT3/vimentin signaling pathway participates in regulating the proliferation and migration of human colon cancer cells.
20358301 Increased VIM mRNA expression is associated with tumor invasion and lymph node metastasis in gastric cancer.
20350213 vimentin is a useful additional diagnostic marker in the assessment of problematic cervical glandular lesions
20176112 Data present the crystal structure of human vimentin fragment including residues 261-335 i.e. approximately the first half of coil 2.
20171211 the binding of filamin A to vimentin and protein kinase C epsilon is an essential regulatory step for the trafficking and activation of beta1 integrins and cell spreading on collagen
20169076 Data show that specific forms of vimentin can be surrogate molecular indicators of the invasive/infiltrative phenotype in tumors.
20121168 Vimentin was found significantly overexpressed in HCC, in particular the small-size subgroup. When tested in the serum samples, vimentin level was significantly higher in small tumors than the nonneoplastic controls.
20109457 Over-expression of Akt2 up-regulates vimentin expression by an increased mRNA stability. Dataq support the hypothesis that IFs are involved in PI3K/Akt pathway.
20104255 Decreased expression of PEDF in primary human lens epithelial cells resulted in a decrease in the expression of vimentin and the increase of alphaB-crystallin expression, two proteins critical for maintaining lens clarity.
19937731 we describe a novel role for the intermediate filament vimentin as a positive regulator of adult human bone marrow-derived multipotent progenitor cell chondrogenesis.
19915524 The combination of the upregulation of vimentin and aberrant expression of E-cadherin/beta-catenin complexes at the tumour invasive front may provide a useful prognostic marker in oral squamous cell carcinoma.
19888472 analysis of immobilized vimentin intermediate filaments on different surfaces
19806221 analysis of the atomistic-level model of the human vimentin dimer and tetramer and their response to mechanical tensile stress
19776392 Filamin A associates with vimentin and protein kinase C-epsilon, thereby enabling vimentin phosphorylation, which is important for beta1 integrin activation and cell spreading on collagen.
19696622 p16-marker testing does not add value to the conventional 3-marker (ER/Vim/CEA) panel in distinguishing between primary endocervical adenocarcinomas and endometrial adenocarcinomas
19695088 Survival analysis showed that vimentin did not help to delineate basal type phenotype in a triple negative (ER, PgR, HER2-negative) group
19690979 The presented data suggest that alternative promoter usage and alternative splicing could be regulatory mechanisms participating in vimentin gene regulation.
19655254 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
19617759 the promoter hypermethylation for methylguanine DNA methyltransferase, human Mut L homolog-1, and vimentin in stool samples is a feasible epigenetic marker that is a sensitive, specific, and noninvasive alternative for colorectal cancer screening.
19528485 Frequent methylation of Vimentin is associated with well-differentiated gastric carcinoma.
19476621 The three markers (ER, Vim and CEA) and their respective panel expressions showed statistically significant (p < 0.05) frequency differences between endocervical adenocarcinomas and endometrial adenocarcinomas tumors.
19447876 Results show there was high risk of biochemical recurrence associated with tumors that displayed high levels of expression of TGF-beta1, vimentin, and NF-kappaB and low level of cytokeratin 18.
19422834 The low propensity of the wild-type coil 1A to form a stable two-stranded coiled coil is most likely a prerequisite for the end-to-end annealing of unit-length filaments into filaments.
19404921 Loss of cytokeratin and gain of vimentin expression are indicators of biologically aggressive breast carcinoma.
19403668 An intact vimentin network is required for cytomegalovirus infection onset.
19386766 The upregulation of vimentin expression during epithelial to mesenchymal transitions may stabilize Scrib to promote directed cell migration.
19366731 Data show that intermediate filament recruitment to focal adhesions in endothelial cells requires beta3 integrin, plectin and the microtubule cytoskeleton, and is dependent on microtubule motors.
19331162 Vimentin was frequently methylated in advanced colorectal carcinoma.
19252475 immunohistochemistry, using a panel composed of desmin, smoothelin, and vimentin, may be potentially useful for staging of bladder carcinoma.
19168853 Characteristic giant axonal neuropathy (GAN) mutant-induced ovoid aggregates of vimentin are not produced in normal fibroblasts after disrupting microtubule assembly, either by TBCE overexpression or depolymerizing drugs.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19126778 These results reveal for the first time an important functional role for vimentin in the maintenance of lens integrity.
19117942 Head and rod 1 interactions in vimentin: identification of contact sites, structure, and changes with phosphorylation using site-directed spin labeling and electron paramagnetic resonance.
19013628 These findings suggest that the turnover rate of hepatitis C virus core protein is regulated by cellular vimentin content.
18985821 Solitary fibrous tumor of the liver expressing CD34 and vimentin: a case report.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18947333 Our results argue for the involvement of galectin-1 in the PKCepsilon/vimentin-controlled trafficking of integrin-beta1
18790770 The role of vimentin in proliferation and motility, was studied.
18695932 vimentin is required for dengue virus serotype 2 infection.
18681838 Endosomal lipid accumulation in Niemann-Pick type C1 disease leads to inhibition of protein kinase C, hypophosphorylation of vimentin and Rab9 entrapment.
18653473 the O-GlcNAc cycling enzymes associate with kinases and phosphatases at M phase to regulate the posttranslational status of vimentin
18632620 coordination of vimentin and detyrosinated microtubules provides structural support for the extensive microtentacles observed in detached tumor cells and a possible mechanism to promote successful metastatic spread
18464297 Affects prostate cancer cells motility and invasiveness.
18407667 ability of Surfactant protein A to interact with desmin and vimentin, and to prevent polymerization of desmin monomers, shed light on unexpected and wider biological roles of this collectin
18241054 Vimentin isoforms are differentially expressed in normal and transformed astrocytes.
18219106 Primary colorectal carcinomas display aberrant expression of vimentin, and have activated Notch and TGFbeta signaling pathways.
18184460 The protein level of vimentin was higher in PC-3M-1E8 cells with high metastatic potential than in PC-3M-2B4 cells with low metastatic potential.
18176708 Immunohistochemical identification of the combination of calponin and vimentin is suggested for the identification of myoepithelial cells in salivary gland tumors.
18155753 The interstitial vimentin immunopositivity correlated with sclerotic/fibrotic lesions (interstitial fibrosis, tubular atrophies, vascular hyalinosis/fibrosis, chronicity index), and negatively with glomerular filtration rate.
18046501 The vimentin expression patterns in human malignant glioma cells strongly depend on cellular density, algorithms of drug delivery and chemo/radio treatment.
17960581 Rults indicate that cysteine 328 in vimention is the main site for prostaglandin PGA(1) addition.
17719575 The suppression of vimentin expression by ras, and the relief of this suppression by TGFbeta, occurs in a promoter-independent fashion, possibly through sequences in the first or second intron.
17703067 study of vimentin protein filament structure and assembly by electron paramagnetic resonance spectroscopy of site-directed spin labels. Review.
17663720 ZBP-89 functions as a repressor by recruiting HDAC1 to the vimentin promoter.
17652163 The nestin(-) vimentin(+) fibroblasts may represent a novel type of multipotent adult stem cells in human dermis.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17585878 In conclusion, ablation of vimentin expression inhibits migration and invasion of colon and breast cancer cell lines.
17476115 Vimentin is a major arterial substrate for transglutaminases.Transglutaminase-mediated vimentin dimerization produces a novel unifying pathway by which vasodilatory and remodeling responses may be regulated.
17403663 a kinetic model for the in vitro assembly of intermediate filaments from tetrameric vimentin
17289402 Vimentin filaments in cross-section exhibit predominantly a four-stranded protofibrilar organization with a right-handed supertwist with a helical pitch of about 96 nm.
17083913 The regulatory protease factor Xa is able to cleave IbeA between R297 and K298 residues, and this cleavage abolishes the IbeA-vimentin interaction.
17056548 Vimentin is involved in binding of NKp46 to M. tuberculosis H37Ra-infected mononuclear phagocytes.
17050693 unit-length filaments appears to be a dynamic and a relatively loosely packed structure with a roughly even mass distribution over its cross-section
17031402 Increased vimentin expression was found in pseudomyxoma peritonei.
16912072 Data show that the architecture of the vimentin cytoskeleton is modified by perturbation of the GTPase ARF1.
16901892 actin and vimentin filaments can interact directly through the tail domain of vimentin
16703512 isolated & identified vimentin as the major skeletal-muscle group A streptococcus (GAS)-binding protein; vimentin expression was up-regulated on injured skeletal-muscle cells in vitro and was expressed in muscle tissues from a patient with GAS myonecrosis
16568083 regulation of vimentin is controlled by SIP1 in breast neoplasms
16487365 All polyps were immunohistochemically positive for vimentin.
16365157 Apoptotic neutrophils express vimentin on their surface; these cells may participate in the development of autoantibodies directed against cytoskeletal proteins, a condition frequently reported in several inflammatory diseases.
16298568 Kidney recipients from non-heart-beating donors showed higher levels of anti-vimentin antibodies than heart-beating donors.
16270034 Results indicate that protein kinase C epsilon-mediated phosphorylation of vimentin is a key process in integrin traffic through the cell.
15777792 Interacts with alpha2beta1-enriched focal adhesions and this association is lost after prolonged adhesion of endothelial cells to collagen.
15556930 examination of mutation the LNDR to LNDS motif in vimentin to examine role in epidermolysis bullosa simplex
15456890 Data suggest that the PAL-E antibody defines secretion of vimentin as a molecular distinction among endothelial cells and exposes a novel, extracellular role for vimentin in the blood vasculature.
15255035 It is unlikely that ependymal vimentin is directly involved in the pathogenesis of Chiari II malformation, but may reflect a secondary upregulation due to defective expression of another gene.
15231822 study of human vimentin rod 1 structure and the sequencing of assembly steps in intermediate filament formation
14595690 findings implicate reduced vimentin in the conversion of these tumorigenic prostate epithelial cells into slow growing, less aggressive cells
12906105 High MW vimentin was formed after the digestion of vimentin by caspase-3 but not caspase-8. It acted as an autoantigen to form anti-vimentin autoantibody in vivo.
12829607 vimentin, in conjunction with low molecular weight heparan sulfate proteoglycans, contributes to the enhanced binding of human group IIA PLA2 to apoptotic T cells
12761892 role of mitogen-activated protein kinase-activated protein kinase-2 phosphorylation in retaining assembly capacity
12750294 The vimentin promoter is a target of the beta-catenin/TCF pathway and strongly suggest an implication of this regulation in epithelial cell migration/invasion in breast cancer.
12727854 vimentin expression contributes to the invasive phenotype in androgen-independent prostate cancer but cannot confer it alone.
12600646 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
12483219 It is secreted by activated monocyte-derived macrophages
12466525 The 3' untranslated region of human vimentin mRNA binds protein complexes containing eEF-1gamma and HAX-1.
12366696 specific interaction of the periplakin linker domain with keratin 8 and vimentin
12210485 expression correlated with motility of prostate carcinoma cells, poor cell differentiation, and presence of bone metastasis
12194205 Results describe the asymmetric distribution of vimentin in the human sperm head.
12169273 Menin's interaction with glial fibrillary acidic protein and vimentin suggests a role for the intermediate filament network in regulating menin activity.
12084347 Vimentin expression correlates with the cytoplasmic localization of wild-type p53 in human primary glioblastoma.
11827972 association with MICAL, a novel CasL interacting molecule
11744725 These findings suggest that platelet vimentin may regulate fibrinolysis in plasma and thrombi by binding platelet-derived Vn.PAI-1 complexes.
11172097 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
11160829 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
10845700 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
10613270 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
10491200 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
9188594 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
8997639 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
8822624 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
8523563 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
8424456 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
8381971 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
7842474 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
2203542 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
2201025 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
2059552 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
1991513 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
1812754 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
1726101 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages
1516138 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of vimentin (VIM) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRL      1 - 70
RSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG     71 - 140
QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDV    141 - 210
DNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVA    211 - 280
AKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN    281 - 350
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS    351 - 420
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE                            421 - 466
//

Text Mined References (362)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27069130 2016 Vimentin Regulates Invasiveness and Is a Poor Prognostic Marker in Non-small Cell Lung Cancer.
27048119 2016 Role of TWIST2, E-cadherin and Vimentin in epithelial ovarian carcinogenesis and prognosis and their interaction in cancer progression.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26708270 2016 Interleukin?6 induces epithelial?mesenchymal transition in human intrahepatic biliary epithelial cells.
26702618 2015 The number of polyploid giant cancer cells and epithelial-mesenchymal transition-related proteins are associated with invasion and metastasis in human breast cancer.
26646105 2016 Vimentin-mediated regulation of cell motility through modulation of beta4 integrin protein levels in oral tumor derived cells.
26617803 2015 Pituitary tumor transforming gene PTTG2 induces psoriasis by regulating vimentin and E-cadherin expression.
26567912 2016 Down-regulation of MicroRNAs (MiRs) 203, 887, 3619 and 182 Prevents Vimentin-triggered, Phospholipase D (PLD)-mediated Cancer Cell Invasion.
26499837 2016 Proteomic Analysis Revealed the Important Role of Vimentin in Human Cervical Carcinoma HeLa Cells Treated With Gambogic Acid.
26466680 2015 CARMIL2 is a novel molecular connection between vimentin and actin essential for cell migration and invadopodia formation.
26180933 2016 Cystic Renal Oncocytoma and Tubulocystic Renal Cell Carcinoma: Morphologic and Immunohistochemical Comparative Study.
26168186 2015 The involvement of vimentin in copper-induced regression of cardiomyocyte hypertrophy.
26161965 2015 Co-Orientation: Quantifying Simultaneous Co-Localization and Orientational Alignment of Filaments in Light Microscopy.
26160837 2015 Long non-coding RNA AOC4P suppresses hepatocellular carcinoma metastasis by enhancing vimentin degradation and inhibiting epithelial-mesenchymal transition.
26149185 2015 Comparative analysis of autoantibodies targeting peptidylarginine deiminase type 4, mutated citrullinated vimentin and cyclic citrullinated peptides in rheumatoid arthritis: associations with cytokine profiles, clinical and genetic features.
26109569 2015 Vimentin filament precursors exchange subunits in an ATP-dependent manner.
26045832 2015 Expression of E-cadherin and vimentin in oral squamous cell carcinoma.
26031447 2015 Vimentin filament organization and stress sensing depend on its single cysteine residue and zinc binding.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25904701 2015 Urinary vimentin mRNA as a potential novel biomarker of renal fibrosis.
25902909 2015 Hypermethylation of ITGA4, TFPI2 and VIMENTIN promoters is increased in inflamed colon tissue: putative risk markers for colitis-associated cancer.
25855378 2015 Vimentin-ERK Signaling Uncouples Slug Gene Regulatory Function.
25826487 2015 Heterogeneity of collagen secreting cells in gingival fibrosis--an immunohistochemical assessment and a review of the literature.
25820701 2015 Decreased expression of claudin-3 is associated with a poor prognosis and EMT in completely resected squamous cell lung carcinoma.
25736925 2015 C6orf106 enhances NSCLC cell invasion by upregulating vimentin, and downregulating E-cadherin and P120ctn.
25717187 2015 Microtubule-dependent transport and dynamics of vimentin intermediate filaments.
25588502 2015 The MAP kinase-interacting kinases regulate cell migration, vimentin expression and eIF4E/CYFIP1 binding.
25548991 2015 Comparison of the expression of vimentin and actin in spitz nevi and spitzoid malignant melanomas.
25536665 2015 Osteoblastic alkaline phosphatase mRNA is stabilized by binding to vimentin intermediary filaments.
25487874 2015 Cell-surface Vimentin: A mislocalized protein for isolating csVimentin(+) CD133(-) novel stem-like hepatocellular carcinoma cells expressing EMT markers.
25417112 2014 Target-selective protein S-nitrosylation by sequence motif recognition.
25416956 2014 A proteome-scale map of the human interactome network.
25362514 2015 BPTF Associated with EMT Indicates Negative Prognosis in Patients with Hepatocellular Carcinoma.
25329121 2014 The expression of CK19, vimentin and E-cadherin in differentiated thyroid carcinomas.
25322343 2014 Large-scale proteomic characterization of melanoma expressed proteins reveals nestin and vimentin as biomarkers that can potentially distinguish melanoma subtypes.
25306868 2014 Vimentin is a dominant target of in situ humoral immunity in human lupus tubulointerstitial nephritis.
25288153 2015 Stress Conditions Increase Vimentin Cleavage by Omi/HtrA2 Protease in Human Primary Neurons and Differentiated Neuroblastoma Cells.
25282138 2014 Evaluation of E-cadherin, ?-catenin and vimentin protein expression using quantitative immunohistochemistry in nasopharyngeal carcinoma patients.
25278713 2014 Negative methylation status of vimentin predicts improved prognosis in pancreatic carcinoma.
25211928 [Prognostic value of ki-67 and vimentin markers in patients with metastatic kidney cancer].
25189876 Selected cyclic citrullinated peptides derived from the sequence of mutated and citrullinated vimentin (MCV) are targeted by different antibodies subclasses in patients with rheumatoid arthritis in Russian patients.
25187410 2014 Vimentin-a potential biomarker for therapeutic efficiency of HAART.
25120060 2014 Expression of cytokeratin 8, vimentin, syndecan-1 and Ki-67 during human tooth development.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25075038 2014 Serum vimentin methylation as a potential marker for colorectal cancer.
25028191 2015 Expression of vimentin and survivin in clear cell renal cell carcinoma and correlation with p53.
25001935 2014 [Vimentin gene transfection promotes the invasion of bladder cancer SW780 cells].
24978037 2014 Role of anti-vimentin antibodies in renal transplantation.
24954475 2014 Anti-microRNA-378a enhances wound healing process by upregulating integrin beta-3 and vimentin.
24942637 2014 Aberrant methylation of the VIM promoter in uterine cervical squamous cell carcinoma.
24858039 2015 Vimentin regulates lung cancer cell adhesion through a VAV2-Rac1 pathway to control focal adhesion kinase activity.
24850148 2014 Vimentin is involved in peptidylarginine deiminase 2-induced apoptosis of activated Jurkat cells.
24843142 2014 Dynamic JUNQ inclusion bodies are asymmetrically inherited in mammalian cell lines through the asymmetric partitioning of vimentin.
24792370 2014 Identification and fine mapping of a linear B cell epitope of human vimentin.
24781336 2014 Abnormal expression of EMT-related proteins, S100A4, vimentin and E-cadherin, is correlated with clinicopathological features and prognosis in HCC.
24737666 2014 Altered vimentin protein expression in human dermal microvascular endothelial cells after ultraviolet or intense pulsed light treatment.
24729088 2014 Aberrant promoter methylation of the vimentin gene may contribute to colorectal carcinogenesis: a meta-analysis.
24681739 2014 Differential vimentin expression in ovarian and uterine corpus endometrioid adenocarcinomas: diagnostic utility in distinguishing double primaries from metastatic tumors.
24657653 2014 Oxidored-nitro domain containing protein 1 (NOR1) expression suppresses slug/vimentin but not snail in nasopharyngeal carcinoma: Inhibition of EMT in vitro and in vivo in mice.
24652946 2014 Microtubule-dependent transport of vimentin filament precursors is regulated by actin and by the concerted action of Rho- and p21-activated kinases.
24642750 2014 Platelet adhesion involves a novel interaction between vimentin and von Willebrand factor under high shear stress.
24623428 2014 Cell surface vimentin is an attachment receptor for enterovirus 71.
24612689 2014 Vimentin silencing effect on invasive and migration characteristics of doxorubicin resistant MCF-7 cells.
24505633 2013 [Investigation of cytokeratin and vimentin intermediate filaments in polycystic ovaries (PCOS) -- presence and specific structure of Balbiani body in primordial follicles].
24474778 2014 Oncogenes induce a vimentin filament collapse mediated by HDAC6 that is linked to cell stiffness.
24447545 2014 RUNX3 regulates vimentin expression via miR-30a during epithelial-mesenchymal transition in gastric cancer cells.
24387004 2014 Vimentin as an integral regulator of cell adhesion and endothelial sprouting.
24284321 2014 Cellular vimentin regulates construction of dengue virus replication complexes through interaction with NS4A protein.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24196446 2014 Inhibition of endocytic vesicle fusion by Plk1-mediated phosphorylation of vimentin during mitosis.
24173714 2014 Substrate stiffness regulates solubility of cellular vimentin.
24139214 2013 P-cadherin and vimentin are useful basal markers in breast cancers.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24075276 2013 Epithelial-to-mesenchymal transition predicts prognosis of pancreatic cancer.
24061457 Expression of vimentin in breast carcinoma, its correlation with Ki67 and other histopathological parameters.
24005669 2013 Proteomic profiling of endothelial invasion revealed receptor for activated C kinase 1 (RACK1) complexed with vimentin to regulate focal adhesion kinase (FAK).
24001454 2013 Increased expression of Slug and Vimentin as novel predictive biomarkers for lymph node metastasis and poor prognosis in colorectal cancer.
23991044 2013 Oleanolic acid suppresses migration and invasion of malignant glioma cells by inactivating MAPK/ERK signaling pathway.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23974215 2013 Vimentin is a target of PKC? phosphorylation in MCP-1-activated primary human monocytes.
23885566 [Role of vimentin in cell migration].
23873106 2013 microRNA-148a suppresses human gastric cancer cell metastasis by reversing epithelial-to-mesenchymal transition.
23831462 2013 Changes in vimentin, lamin A/C and mitofilin induceĀ aberrant cell organization in fibroblasts from Fanconi anemia complementation group A (FA-A) patients.
23824807 2013 Cell susceptibility to baculovirus transduction and echovirus infection is modified by protein kinase C phosphorylation and vimentin organization.
23785295 2013 PARP-1 regulates metastatic melanoma through modulation of vimentin-induced malignant transformation.
23773638 2013 Comparison of anti-mutated citrullinated vimentin, anti-cyclic citrullinated peptides, anti-glucose-6-phosphate isomerase and anti-keratin antibodies and rheumatoid factor in the diagnosis of rheumatoid arthritis in Chinese patients.
23751022 2013 Clinical significance of vimentin expression and Her-2 status in patients with gastric carcinoma.
23717685 2013 Variable metastatic potentials correlate with differential plectin and vimentin expression in syngeneic androgen independent prostate cancer cells.
23682784 2013 In vitro and in vivo effects of phenethyl isothiocyanate treatment on vimentin protein expression in cancer cells.
23677639 2013 In vitro treatment of carcinoma cell lines with pancreatic (pro)enzymes suppresses the EMT programme and promotes cell differentiation.
23674515 2013 Vimentin is an endogenous ligand for the pattern recognition receptor Dectin-1.
23663103 2013 Streptococcal-vimentin cross-reactive antibodies induce microvascular cardiac endothelial proinflammatory phenotype in rheumatic heart disease.
23614934 2013 Prediction of BRCA1 germ-line mutation status in patients with breast cancer using histoprognosis grade, MS110, Lys27H3, vimentin, and KI67.
23576498 2013 Foot-and-mouth disease virus modulates cellular vimentin for virus survival.
23562674 2013 Vimentin expression predicts the occurrence of metastases in non small cell lung carcinomas.
23504025 2013 KLF8 involves in TGF-beta-induced EMT and promotes invasion and migration in gastric cancer cells.
23482564 2013 Selective inhibition of human group IIA-secreted phospholipase A2 (hGIIA) signaling reveals arachidonic acid metabolism is associated with colocalization of hGIIA to vimentin in rheumatoid synoviocytes.
23418554 2013 Simultaneous multi-antibody staining in non-small cell lung cancer strengthens diagnostic accuracy especially in small tissue samples.
23418544 2013 Identification of novel autoantigen in the synovial fluid of rheumatoid arthritis patients using an immunoproteomics approach.
23412770 2013 Vimentin, zeb1 and Sip1 are up-regulated in triple-negative and basal-like breast cancers: association with an aggressive tumour phenotype.
23357686 2013 Vimentin is a component of a complex that binds to the 5'-UTR of human heme-regulated eIF2? kinase mRNA and regulates its translation.
23354842 2013 Vimentin as a poor prognostic factor for triple-negative breast cancer.
23325789 2013 cAMP-stimulated phosphorylation of diaphanous 1 regulates protein stability and interaction with binding partners in adrenocortical cells.
23295955 2013 High-throughput RNAi screening for novel modulators of vimentin expression identifies MTHFD2 as a regulator of breast cancer cell migration and invasion.
23292832 2013 Prognostic role of E-cadherin and Vimentin expression in various subtypes of soft tissue leiomyosarcomas.
23291835 2012 Ultra-high-resolution images of nestin and vimentin in pancreatic carcinoma cells using 2 novel microscopy systems.
23280360 2013 Circulating citrullinated vimentin fragments reflect disease burden in ankylosing spondylitis and have prognostic capacity for radiographic progression.
23239149 2013 Vimentin DNA methylation predicts survival in breast cancer.
23224145 2013 MicroRNA-30c targets cytoskeleton genes involved in breast cancer cell invasion.
23221510 2013 Differential expression of fascin, E-cadherin and vimentin: Proteins associated with survival of cholangiocarcinoma patients.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23135265 2013 The intermediate filament vimentin mediates microRNA miR-378 function in cellular self-renewal by regulating the expression of the Sox2 transcription factor.
23072594 2013 Nestin and vimentin colocalization affects the subcellular location of glucocorticoid receptor in cutaneous melanoma.
23056278 2012 Diagnosis of bladder cancer recurrence based on urinary levels of EOMES, HOXA9, POU4F2, TWIST1, VIM, and ZNF154 hypermethylation.
23049725 2012 The function of SARI in modulating epithelial-mesenchymal transition and lung adenocarcinoma metastasis.
22929228 2012 ROCK-phosphorylated vimentin modifies mutant huntingtin aggregation via sequestration of IRBIT.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22886823 2013 Dysregulated expression of Slug, vimentin, and E-cadherin correlates with poor clinical outcome in patients with basal-like breast cancer.
22879973 2012 Characterization of a human 12/15-lipoxygenase promoter variant associated with atherosclerosis identifies vimentin as a promoter binding protein.
22869704 2012 Atomic structure of the vimentin central ?-helical domain and its implications for intermediate filament assembly.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22766839 2012 Tumor suppressive microRNA?138 contributes to cell migration and invasion through its targeting of vimentin in renal cell carcinoma.
22763828 2012 Expression of PCNA, ICAM-1, and vimentin in lens epithelial cells of cataract patients with and without type 2 diabetes.
22759266 2012 Propionibacterium acnes host cell tropism contributes to vimentin-mediated invasion and induction of inflammation.
22740688 2012 The structure of vimentin linker 1 and rod 1B domains characterized by site-directed spin-labeling electron paramagnetic resonance (SDSL-EPR) and X-ray crystallography.
22730818 2012 [Expression and significance of vimentin in different types of chronic rhinosinusitis].
22704062 2012 Epithelial to mesenchymal transition (EMT) biomarkers--E-cadherin, beta-catenin, APC and Vimentin--in oral squamous cell carcinogenesis and transformation.
22684479 2013 The intermediate filament protein, vimentin, is a regulator of NOD2 activity.
22659602 2012 DNA damage, discoordinated gene expression and cellular senescence in osteoarthritic chondrocytes.
22644514 2013 Expression of mesenchymal markers vimentin and fibronectin: the clinical significance in esophageal squamous cell carcinoma.
22584948 2012 Acquired resistance to peloruside A and laulimalide is associated with downregulation of vimentin in human ovarian carcinoma cells.
22535769 2012 Ablation of vimentin results in defective steroidogenesis.
22476851 2012 MicroRNA-30a inhibits cell migration and invasion by downregulating vimentin expression and is a potential prognostic marker in breast cancer.
22407449 2012 Calpain-mediated vimentin cleavage occurs upstream of MT1-MMP membrane translocation to facilitate endothelial sprout initiation.
22395512 2012 Vascular and mesenchymal factors during heart development: a chronological study.
22367194 2012 Biochemical characterization and N-terminomics analysis of leukolysin, the membrane-type 6 matrix metalloprotease (MMP25): chemokine and vimentin cleavages enhance cell migration and macrophage phagocytic activities.
22345628 2012 Engulfment and clearance of apoptotic cells based on a GlcNAc-binding lectin-like property of surface vimentin.
22340393 2011 Vimentin significantly promoted gallbladder carcinoma metastasis.
22315367 2012 Aberrant vimentin methylation is characteristic of upper gastrointestinal pathologies.
22307379 2012 Aberrant expression of nuclear vimentin and related epithelial-mesenchymal transition markers in nasopharyngeal carcinoma.
22300583 2012 Rudhira/BCAS3 is a cytoskeletal protein that controls Cdc42 activation and directional cell migration during angiogenesis.
22251609 Detection of hypermethylated vimentin in urine of patients with colorectal cancer.
22236966 2012 HIPK2 downregulates vimentin and inhibits breast cancer cell invasion.
22221700 2012 Significance of E-cadherin, ?-catenin, and vimentin expression as postoperative prognosis indicators in cervical squamous cell carcinoma.
22216242 2011 Soluble CD44 interacts with intermediate filament protein vimentin on endothelial cell surface.
22119849 2012 Stabilization of vimentin coil2 fragment via an engineered disulfide.
22022619 2011 Auto-antibodies to ?-F1-ATPase and vimentin in malignant mesothelioma.
21914078 2011 Association of filamin A and vimentin with hepatitis C virus proteins in infected human hepatocytes.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21803859 2011 Vimentin is sufficient and required for wound repair and remodeling in alveolar epithelial cells.
21803052 2011 Endothelial cell surface vimentin binding peptide induces angiogenesis under hypoxic/ischemic conditions.
21769486 2012 Weak CD4+ T-cell responses to citrullinated vimentin in rheumatoid arthritis patients carrying HLA-DR9 alleles.
21746880 2011 A novel role of vimentin filaments: binding and stabilization of collagen mRNAs.
21699783 2011 TLE1 modifies the effects of NOD2 in the pathogenesis of Crohn's disease.
21664858 2011 Significance of tumor satellite variables in reflecting the epithelial-mesenchymal transition of tongue cancer.
21515330 2011 A mechanism of apigenin-induced apoptosis is potentially related to anti-angiogenesis and anti-migration in human hepatocellular carcinoma cells.
21508377 2011 Aberrant methylation of the Vimentin gene in hepatocellular carcinoma.
21491466 2011 Proteomic analysis of the differentially expressed proteins by airborne nanoparticles.
21465480 2012 Cdk5 mediates vimentin Ser56 phosphorylation during GTP-induced secretion by neutrophils.
21448168 2011 Tumour epithelial vimentin expression and outcome of pancreatic ductal adenocarcinomas.
21442485 2011 [Clinical significance of signal transduction and activators of transcription 3, E-cadherin and vimentin in colon cancer].
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21346197 2011 Vimentin organization modulates the formation of lamellipodia.
21327330 2011 Vimentin expression is associated with decreased survival in gastric cancer.
21317457 2010 Sumoylation of vimentin354 is associated with PIAS3 inhibition of glioma cell migration.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21217813 2010 The eEF1? subunit contacts RNA polymerase II and binds vimentin promoter region.
21199468 2010 Diagnostic value of anti-modified citrullinated vimentin in rheumatoid arthritis.
21187483 2010 Detection of vimentin (VIM) methylation in the serum of colorectal cancer patients.
21094801 2010 Vimentin expression and myofibroblast infiltration are early markers of renal dysfunction in kidney transplantation: an early stage of chronic allograft dysfunction?
21057535 2011 Vimentin regulates EMT induction by Slug and oncogenic H-Ras and migration by governing Axl expression in breast cancer.
20975101 2010 Three epigenetic biomarkers, GDF15, TMEFF2, and VIM, accurately predict bladder cancer from DNA-based analyses of urine samples.
20856200 2011 Vimentin is a novel AKT1 target mediating motility and invasion.
20729920 2010 TRIM16 acts as a tumour suppressor by inhibitory effects on cytoplasmic vimentin and nuclear E2F1 in neuroblastoma cells.
20701774 2010 A novel function for vimentin: the potential biomarker for predicting melanoma hematogenous metastasis.
20651380 2010 Aberrant expression of vimentin correlates with dedifferentiation and poor prognosis in patients with intrahepatic cholangiocarcinoma.
20618440 2010 Proteomic and biochemical analysis of 14-3-3-binding proteins during C2-ceramide-induced apoptosis.
20609218 2010 Citrullinated vimentin as an important antigen in immune complexes from synovial fluid of rheumatoid arthritis patients with antibodies against citrullinated proteins.
20602472 2011 Vimentin contributes to changes in chondrocyte stiffness in osteoarthritis.
20588206 2010 Intragraft tubular vimentin and CD44 expression correlate with long-term renal allograft function and interstitial fibrosis and tubular atrophy.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20447406 2010 Divalent cations crosslink vimentin intermediate filament tail domains to regulate network mechanics.
20422486 2010 [Effect of JAK2/STAT3/vimentin signaling pathway on proliferation and migration of human colon cancer cells].
20358301 2010 The clinical significance of vimentin-expressing gastric cancer cells in bone marrow.
20350213 2010 Diagnostic value and implications of vimentin expression in normal, reactive and neoplastic endocervical epithelium.
20176112 2010 Atomic structure of vimentin coil 2.
20171211 2010 Regulation of cell adhesion to collagen via beta1 integrins is dependent on interactions of filamin A with vimentin and protein kinase C epsilon.
20169076 2010 Increased phosphorylation of vimentin in noninfiltrative meningiomas.
20121168 2010 Proteomics of hepatocellular carcinoma: serum vimentin as a surrogate marker for small tumors (<or=2 cm).
20109457 2010 Akt isoforms regulate intermediate filament protein levels in epithelial carcinoma cells.
20104255 2010 Down regulation of the PEDF gene in human lens epithelium cells changed the expression of proteins vimentin and alphaB-crystallin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068230 2010 Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.
19937731 2010 The intermediate filament vimentin regulates chondrogenesis of adult human bone marrow-derived multipotent progenitor cells.
19915524 2010 Upregulation of vimentin and aberrant expression of E-cadherin/beta-catenin complex in oral squamous cell carcinomas: correlation with the clinicopathological features and patient outcome.
19888472 2009 Filamentous biopolymers on surfaces: atomic force microscopy images compared with Brownian dynamics simulation of filament deposition.
19806221 2009 Hierarchical structure controls nanomechanical properties of vimentin intermediate filaments.
19776392 2010 Filamin A is required for vimentin-mediated cell adhesion and spreading.
19696622 2009 Adding the p16(INK4a) marker to the traditional 3-marker (ER/Vim/CEA) panel engenders no supplemental benefit in distinguishing between primary endocervical and endometrial adenocarcinomas in a tissue microarray study.
19695088 2009 Does vimentin help to delineate the so-called 'basal type breast cancer'?
19690979 2010 Identification of a novel vimentin promoter and mRNA isoform.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19617759 2009 Stool methylation-specific polymerase chain reaction assay for the detection of colorectal neoplasia in Korean patients.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19528485 2009 Frequent methylation of Vimentin in well-differentiated gastric carcinoma.
19476621 2009 Progesterone receptor does not improve the performance and test effectiveness of the conventional 3-marker panel, consisting of estrogen receptor, vimentin and carcinoembryonic antigen in distinguishing between primary endocervical and endometrial adenocarcinomas in a tissue microarray extension study.
19447876 2009 Nuclear factor-kappaB-mediated transforming growth factor-beta-induced expression of vimentin is an independent predictor of biochemical recurrence after radical prostatectomy.
19422834 2009 Vimentin coil 1A-A molecular switch involved in the initiation of filament elongation.
19420356 2009 The prototype endothelial marker PAL-E is a leukocyte trafficking molecule.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19404921 Cytokeratin and vimentin expression in breast cancer.
19403668 2009 Onset of human cytomegalovirus replication in fibroblasts requires the presence of an intact vimentin cytoskeleton.
19386766 2009 Vimentin regulates scribble activity by protecting it from proteasomal degradation.
19366731 2009 Recruitment of vimentin to the cell surface by beta3 integrin and plectin mediates adhesion strength.
19331162 2009 Vimentin methylation as a marker for advanced colorectal carcinoma.
19270731 2009 The cellular distribution of serotonin transporter is impeded on serotonin-altered vimentin network.
19252475 2009 Differential expression of immunohistochemical markers in bladder smooth muscle and myofibroblasts, and the potential utility of desmin, smoothelin, and vimentin in staging of bladder carcinoma.
19168853 2009 Gigaxonin controls vimentin organization through a tubulin chaperone-independent pathway.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19126778 2009 Dominant cataract formation in association with a vimentin assembly disrupting mutation.
19117942 2009 Head and rod 1 interactions in vimentin: identification of contact sites, structure, and changes with phosphorylation using site-directed spin labeling and electron paramagnetic resonance.
19013628 2009 Cellular vimentin content regulates the protein level of hepatitis C virus core protein and the hepatitis C virus production in cultured cells.
18985821 2008 Solitary fibrous tumor of the liver expressing CD34 and vimentin: a case report.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18947333 2010 Galectin-1 is implicated in the protein kinase C epsilon/vimentin-controlled trafficking of integrin-beta1 in glioblastoma cells.
18827015 2008 TorsinA binds the KASH domain of nesprins and participates in linkage between nuclear envelope and cytoskeleton.
18811945 2008 The Serine/threonine kinase Stk33 exhibits autophosphorylation and phosphorylates the intermediate filament protein Vimentin.
18790770 2008 Keratin down-regulation in vimentin-positive cancer cells is reversible by vimentin RNA interference, which inhibits growth and motility.
18695932 2008 Vimentin is required for dengue virus serotype 2 infection but microtubules are not necessary for this process.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18681838 2009 Endosomal lipid accumulation in NPC1 leads to inhibition of PKC, hypophosphorylation of vimentin and Rab9 entrapment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18653473 2008 A mitotic GlcNAcylation/phosphorylation signaling complex alters the posttranslational state of the cytoskeletal protein vimentin.
18632620 2008 Vimentin filaments support extension of tubulin-based microtentacles in detached breast tumor cells.
18464297 Vimentin affects the mobility and invasiveness of prostate cancer cells.
18407667 2008 Interaction of surfactant protein A with the intermediate filaments desmin and vimentin.
18241054 2008 Vimentin isoform expression in the human retina characterized with the monoclonal antibody 3CB2.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18219106 2008 Differential Notch and TGFbeta signaling in primary colorectal tumors and their corresponding metastases.
18184460 2008 [Effects of vimentin on invasion and metastasis of prostate cancer cell lines PC-3M-1E8 and PC-3M-2B4].
18176708 2007 Immunohistochemical expression of vimentin, calponin and HHF-35 in salivary gland tumors.
18155753 2008 Histological, immunohistochemical and biological data in assessing interstitial fibrosis in patients with chronic glomerulonephritis.
18046501 2008 Up-regulation of vimentin expression in low-density malignant glioma cells as immediate and late effects under irradiation and temozolomide treatment.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17960581 2007 Study of protein targets for covalent modification by the antitumoral and anti-inflammatory prostaglandin PGA1: focus on vimentin.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17881773 2007 Peroxisomes in human and mouse testis: differential expression of peroxisomal proteins in germ cells and distinct somatic cell types of the testis.
17719575 2007 Promoter-independent regulation of vimentin expression in mammary epithelial cells by val(12)ras and TGFbeta.
17703067 2007 Describing the structure and assembly of protein filaments by EPR spectroscopy of spin-labeled side chains.
17663720 2007 The zinc finger repressor, ZBP-89, recruits histone deacetylase 1 to repress vimentin gene expression.
17652163 2007 Clonal analysis of nestin(-) vimentin(+) multipotent fibroblasts isolated from human dermis.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17585878 2007 Down-regulation of vimentin expression inhibits carcinoma cell migration and adhesion.
17505058 2007 Estrogen induces expression of BCAS3, a novel estrogen receptor-alpha coactivator, through proline-, glutamic acid-, and leucine-rich protein-1 (PELP1).
17476115 2007 Arterial vimentin is a transglutaminase substrate: a link between vasomotor activity and remodeling?
17403663 2007 A quantitative kinetic model for the in vitro assembly of intermediate filaments from tetrameric vimentin.
17373842 2007 HDM2-binding partners: interaction with translation elongation factor EF1alpha.
17289402 2007 Dissecting the 3-D structure of vimentin intermediate filaments by cryo-electron tomography.
17083913 2006 Identification of a surface protein on human brain microvascular endothelial cells as vimentin interacting with Escherichia coli invasion protein IbeA.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17056548 2006 Vimentin expressed on Mycobacterium tuberculosis-infected human monocytes is involved in binding to the NKp46 receptor.
17050693 2006 Monitoring intermediate filament assembly by small-angle x-ray scattering reveals the molecular architecture of assembly intermediates.
17031402 2006 A specific cadherin phenotype may characterise the disseminating yet non-metastatic behaviour of pseudomyxoma peritonei.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16923132 2006 Interactions between epiplakin and intermediate filaments.
16912072 2006 Architecture of the vimentin cytoskeleton is modified by perturbation of the GTPase ARF1.
16901892 2006 A direct interaction between actin and vimentin filaments mediated by the tail domain of vimentin.
16769727 2006 Protein phosphatase 6 subunit with conserved Sit4-associated protein domain targets IkappaBepsilon.
16712842 2006 Evidence for distinct functions for human DNA repair factors hHR23A and hHR23B.
16703512 2006 Group A streptococcal myonecrosis: increased vimentin expression after skeletal-muscle injury mediates the binding of Streptococcus pyogenes.
16568083 2006 Regulation of vimentin by SIP1 in human epithelial breast tumor cells.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16487365 2006 Fibroblastic polyp of the colon: clinicopathological analysis of 10 cases with emphasis on its common association with serrated crypts.
16365157 2006 Cell surface expression of intermediate filament proteins vimentin and lamin B1 in human neutrophil spontaneous apoptosis.
16361107 2006 Dystonia-causing mutant torsinA inhibits cell adhesion and neurite extension through interference with cytoskeletal dynamics.
16298568 2005 Anti-vimentin antibody detection in recipients of heart-beating and non-heart beating donor kidneys.
16270034 2005 PKCepsilon-mediated phosphorylation of vimentin controls integrin recycling and motility.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15846844 2005 Proteomic profiling of cellular proteins interacting with the hepatitis C virus core protein.
15777792 2005 The intermediate filament protein vimentin binds specifically to a recombinant integrin alpha2/beta1 cytoplasmic tail complex and co-localizes with native alpha2/beta1 in endothelial cell focal adhesions.
15671067 2005 Characterization of human epiplakin: RNAi-mediated epiplakin depletion leads to the disruption of keratin and vimentin IF networks.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15556930 2005 Characterization of structural changes in vimentin bearing an epidermolysis bullosa simplex-like mutation using site-directed spin labeling and electron paramagnetic resonance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456890 2004 The endothelial cell-specific antibody PAL-E identifies a secreted form of vimentin in the blood vasculature.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15255035 Regional ependymal upregulation of vimentin in Chiari II malformation, aqueductal stenosis, and hydromyelia.
15231822 2004 Structural characterization of human vimentin rod 1 and the sequencing of assembly steps in intermediate filament formation in vitro using site-directed spin labeling and electron paramagnetic resonance.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15161933 2004 Comprehensive proteomic analysis of interphase and mitotic 14-3-3-binding proteins.
14996095 2004 SEREX identification of new tumour-associated antigens in cutaneous T-cell lymphoma.
14762106 2004 Specific in vivo phosphorylation sites determine the assembly dynamics of vimentin intermediate filaments.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14595690 2003 Proteomic analysis of the tumorigenic human prostate cell line M12 after microcell-mediated transfer of chromosome 19 demonstrates reduction of vimentin.
12906105 2003 High molecular weight vimentin complex is formed after proteolytic digestion of vimentin by caspase-3: detection by sera of patients with interstitial pneumonia.
12829607 2003 Identification of an autoantigen on the surface of apoptotic human T cells as a new protein interacting with inflammatory group IIA phospholipase A2.
12761892 2003 Retaining of the assembly capability of vimentin phosphorylated by mitogen-activated protein kinase-activated protein kinase-2.
12750294 2003 Transactivation of vimentin by beta-catenin in human breast cancer cells.
12727854 2003 Overexpression of vimentin: role in the invasive phenotype in an androgen-independent model of prostate cancer.
12706117 2003 The architecture of microtubular network and Golgi orientation in osteoclasts--major differences between avian and mammalian species.
12600646 2003 The role of Vif during HIV-1 infection: interaction with novel host cellular factors.
12483219 2003 Vimentin is secreted by activated macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466525 2002 The 3' untranslated region of human vimentin mRNA interacts with protein complexes containing eEF-1gamma and HAX-1.
12458200 2003 Aurora-B regulates the cleavage furrow-specific vimentin phosphorylation in the cytokinetic process.
12429849 2002 Functional proteomic analysis of human nucleolus.
12366696 2002 Unique role for the periplakin tail in intermediate filament association: specific binding to keratin 8 and vimentin.
12210485 2002 Enhanced expression of vimentin in motile prostate cell lines and in poorly differentiated and metastatic prostate carcinoma.
12194205 2002 Asymmetric vimentin distribution in human spermatozoa.
12169273 2002 Menin's interaction with glial fibrillary acidic protein and vimentin suggests a role for the intermediate filament network in regulating menin activity.
12084347 2002 Cytoplasmic localization of wild-type p53 in glioblastomas correlates with expression of vimentin and glial fibrillary acidic protein.
12003790 2002 Histamine stimulates phosphorylation of adherens junction proteins and alters their link to vimentin.
11911279 Remodeling of vimentin cytoskeleton correlates with enhanced motility of promyelocytic leukemia cells during differentiation induced by retinoic acid.
11895474 2002 Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK).
11889032 2002 Conserved segments 1A and 2B of the intermediate filament dimer: their atomic structures and role in filament assembly.
11827972 2002 MICAL, a novel CasL interacting molecule, associates with vimentin.
11802775 2002 Oxysterol-binding-protein (OSBP)-related protein 4 binds 25-hydroxycholesterol and interacts with vimentin intermediate filaments.
11581269 2001 Polycystin-1 interacts with intermediate filaments.
11514563 2001 Identification of a caspase-9 substrate and detection of its cleavage in programmed cell death during mouse development.
11441066 2001 Cutting edge: integration of human T lymphocyte cytoskeleton by the cytolinker plectin.
11423904 2001 Caspase cleavage of vimentin disrupts intermediate filaments and promotes apoptosis.
11243787 2001 Divide-and-conquer crystallographic approach towards an atomic structure of intermediate filaments.
11172097 2001 Fully functional, naturally occurring and C-terminally truncated variant human immunodeficiency virus (HIV) Vif does not bind to HIV Gag but influences intermediate filament structure.
11082283 2000 Nucleoside diphosphate kinase beta (Nm23-R1/NDPKbeta) is associated with intermediate filaments and becomes upregulated upon cAMP-induced differentiation of rat C6 glioma.
10887173 2000 Calyculin A-induced vimentin phosphorylation sequesters 14-3-3 and displaces other 14-3-3 partners in vivo.
10852918 2000 Activation of Ca2+/calmodulin-dependent protein kinase II within post-synaptic dendritic spines of cultured hippocampal neurons.
10852826 2000 Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis.
10613270 1999 [Vimentin intermediate filaments are involved in replication of human immunodeficiency virus type I].
10469173 1999 Changes in nuclear morphology during apoptosis correlate with vimentin cleavage by different caspases located either upstream or downstream of Bcl-2 action.
9565595 1998 Phosphorylation of vimentin by Rho-associated kinase at a unique amino-terminal site that is specifically phosphorylated during cytokinesis.
9261168 1997 Two-hybrid analysis reveals fundamental differences in direct interactions between desmoplakin and cell type-specific intermediate filaments.
9190204 1997 Topogenesis of a nucleolar protein: determination of molecular segments directing nucleolar association.
9188594 1997 The Vif and Gag proteins of human immunodeficiency virus type 1 colocalize in infected human T cells.
9175763 1997 Domain-specific phosphorylation of vimentin and glial fibrillary acidic protein by PKN.
9150946 Two-dimensional electrophoretic analysis of human breast carcinoma proteins: mapping of proteins that bind to the SH3 domain of mixed lineage kinase MLK2.
8523563 1996 Cytoskeleton association and virion incorporation of the human immunodeficiency virus type 1 Vif protein.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7983050 1994 Visualization and function of vimentin phosphorylation by cdc2 kinase during mitosis.
7925640 1994 Colocalization of nestin and vimentin/desmin in skeletal muscle cells demonstrated by three-dimensional fluorescence digital imaging microscopy.
7644499 1995 The product of the ataxia-telangiectasia group D complementing gene, ATDC, interacts with a protein kinase C substrate and inhibitor.
3792301 1986 Vimentin gene: expression in human lymphocytes and in Burkitt's lymphoma cells.
3661560 1987 The gene encoding human vimentin is located on the short arm of chromosome 10.
3467175 1986 Coding sequence and growth regulation of the human vimentin gene.
3371665 1988 Nucleotide sequence of the human vimentin gene and regulation of its transcription in tissues and cultured cells.
3027087 1987 Plectin and IFAP-300K are homologous proteins binding to microtubule-associated proteins 1 and 2 and to the 240-kilodalton subunit of spectrin.
2806127 1989 Expression of intermediate filament proteins during development of Xenopus laevis. I. cDNA clones encoding different forms of vimentin.
2472876 1989 Vimentin rather than keratin expression in some hormone-independent breast cancer cell lines and in oncogene-transformed mammary epithelial cells.
2323579 1990 Isolation of a human vimentin cDNA with a long 3'-noncoding region from a human osteosarcoma cell line (MG-63).
2251132 1990 Nucleotide sequence of cDNA covering the complete coding part of the human vimentin gene.
1918147 1991 Filensin: a new vimentin-binding, polymerization-competent, and membrane-associated protein of the lens fiber cell.
1722806 1991 Expression of intermediate filament in endometrial glands changes with the onset of pregnancy and in endometriosis.
1478967 1992 Membrane-binding properties of filensin, a cytoskeletal protein of the lens fiber cells.