Property Summary

NCBI Gene PubMed Count 45
PubMed Score 153.65
PubTator Score 83.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.200 5.5e-04
esophageal adenocarcinoma 1.500 3.2e-02
intraductal papillary-mucinous adenoma (... -1.100 2.3e-02
intraductal papillary-mucinous carcinoma... 1.700 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.800 1.2e-02
pancreatic carcinoma 1.200 5.5e-04
lung carcinoma 1.400 3.8e-07
ulcerative colitis -1.400 3.0e-05
ovarian cancer -1.500 3.5e-06
psoriasis -1.300 1.6e-07

Gene RIF (20)

PMID Text
26658611 villin directly interacts with a transcriptional corepressor and ligand of the Slug promoter, ZBRK1.
26537799 Data indicate an association between highly fucosylated glycans and caudal type homeobox 1 (CDX1) and/or villin mRNA expression that both correlate with cell differentiation.
26334299 study demonstrates that G. duodenalis-mediated disruption of villin is, at least, in part dependent on activation of myosin light chain kinase
25600187 Thus, villin plays an important role in establishing the balance between actin polymerization and actin severing to facilitate the initial steps of Salmonella entry.
25517957 villin immunohistochemistry is a reliable and superior adjunct in the diagnosis of microvillus inclusion disease
25337239 Collective expression pattern of tensin/profilin-1/villin-1/talin could be a biomarker to estimate the prognosis of esophageal squamous cell carcinoma patients.
24266897 Discriminated small-cell lung carcinoma from large-cell neuroendocrine lung carcinoma with immunohistochemical markers BAI3, CDX2 and VIL1.
24250806 harmonin and villin autoantibodies are sensitive and specific markers of IPEX, differentiate IPEX, including atypical cases, from other early childhood disorders associated with enteropathy
22530999 We demonstrated that the VIL1 gene is a potential candidate molecular marker for high serum AFP-associated HCC and a predictive candidate for the postoperative recurrence and poorer prognosis of HCC.
21741320 identified villin, an actin-binding protein, as the 95 kDa antigen in four of five sera from patients with IPEX syndrome
21623163 study confirmed finding of VIL1 as a diagnostic marker of cervical adenocarcinoma
19377296 identified VIL1 as a novel biomarker of cervical adenocarcinoma
19371634 Cdx2 regulates intestinal villin expression through recruiting Brm-type SWI/SNF complex to the villin promoter.
18307996 Villin is an actin regulatory protein that organizes, integrates and regulates multiple epithelial cell functions.
18054784 Together, our results show that in epithelial cells ATX and LPA act as strong stimulators of cell migration by recruiting PLC-gamma 1 and villin, both of which participate in the initiation of protrusion.
17182858 By severing actin filaments and capping their barbed ends, villin increases the concentration of actin monomers available for polymerization.
15576363 H. pylori induction of villin in the stomach correlates with activation and cooperative binding of Elk-1 and the SRF to the proximal promoter of villin
15342783 tyrosine phosphorylation at residues 60, 81, and 256 of human villin plays an essential role in cell migration as well as in the reorganization of the actin cytoskeleton
15272027 villin has calcium-sensitive actin-capping and actin-depolymerizing sites
11500485 Tyrosine phosphorylation of villin regulates the organization of the actin cytoskeleton

AA Sequence

MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDS      1 - 70
SLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLL     71 - 140
HVKGKRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGV    141 - 210
VDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLL    211 - 280
SHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWT    281 - 350
ASNRTSGLGKTHTVGSVAKVEQVKFDATSMHVKPQVAAQQKMVDDGSGEVQVWRIENLELVPVDSKWLGH    351 - 420
FYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMS    421 - 490
IFKGRMVVYQGGTSRTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGK    491 - 560
GCSGDEREMAKMVADTISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENLVITPRLFECSNKTGR    561 - 630
FLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ    631 - 700
GHEPPTFTGWFLAWDPFKWSNTKSYEDLKAELGNSRDWSQITAEVTSPKVDVFNANSNLSSGPLPIFPLE    701 - 770
QLVNKPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEKGLF                 771 - 827
//

Text Mined References (56)

PMID Year Title
26658611 2016 By moonlighting in the nucleus, villin regulates epithelial plasticity.
26537799 2016 N-glycosylation Profiling of Colorectal Cancer Cell Lines Reveals Association of Fucosylation with Differentiation and Caudal Type Homebox 1 (CDX1)/Villin mRNA Expression.
26334299 2015 Giardia duodenalis Surface Cysteine Proteases Induce Cleavage of the Intestinal Epithelial Cytoskeletal Protein Villin via Myosin Light Chain Kinase.
25600187 2015 Apical invasion of intestinal epithelial cells by Salmonella typhimurium requires villin to remodel the brush border actin cytoskeleton.
25517957 2015 Villin immunohistochemistry is a reliable method for diagnosing microvillus inclusion disease.
25337239 2014 A four actin-binding protein signature model for poor prognosis of patients with esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24266897 2014 BAI3, CDX2 and VIL1: a panel of three antibodies to distinguish small cell from large cell neuroendocrine lung carcinomas.
24250806 2013 Autoantibodies to harmonin and villin are diagnostic markers in children with IPEX syndrome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22530999 2012 Villin 1 is a predictive factor for the recurrence of high serum alpha-fetoprotein-associated hepatocellular carcinoma after hepatectomy.
21741320 2011 Autoantibodies to villin occur frequently in IPEX, a severe immune dysregulation, syndrome caused by mutation of FOXP3.
21623163 2011 Villin1, a diagnostic marker for endometrial adenocarcinoma with high grade nuclear atypia.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
19808673 2009 Differential effects of lysophosphatidic acid and phosphatidylinositol 4,5-bisphosphate on actin dynamics by direct association with the actin-binding protein villin.
19491107 2009 Helix straightening as an activation mechanism in the gelsolin superfamily of actin regulatory proteins.
19377296 2009 Villin1, a novel diagnostic marker for cervical adenocarcinoma.
19371634 2009 Cdx2 and the Brm-type SWI/SNF complex cooperatively regulate villin expression in gastrointestinal cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18307996 2008 Regulation of cell structure and function by actin-binding proteins: villin's perspective.
18198174 2008 A novel role for villin in intestinal epithelial cell survival and homeostasis.
18054784 2008 Autotaxin and lysophosphatidic acid stimulate intestinal cell motility by redistribution of the actin modifying protein villin to the developing lamellipodia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17847007 2007 Mutation in WNT10A is associated with an autosomal recessive ectodermal dysplasia: the odonto-onycho-dermal dysplasia.
17606613 2007 Dimerization and actin-bundling properties of villin and its role in the assembly of epithelial cell brush borders.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17229814 2007 Obligatory role for phospholipase C-gamma(1) in villin-induced epithelial cell migration.
17182858 2007 Villin severing activity enhances actin-based motility in vivo.
16921170 2006 Interaction of phospholipase C-gamma1 with villin regulates epithelial cell migration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15576363 2005 Helicobacter-induced intestinal metaplasia in the stomach correlates with Elk-1 and serum response factor induction of villin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342783 2004 Regulation of cell motility by tyrosine phosphorylated villin.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15272027 2004 Functional dissection and molecular characterization of calcium-sensitive actin-capping and actin-depolymerizing sites in villin.
15096633 2004 Solution structures of the C-terminal headpiece subdomains of human villin and advillin, evaluation of headpiece F-actin-binding requirements.
15084600 2004 Identification of a functional switch for actin severing by cytoskeletal proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14594952 2004 Association of villin with phosphatidylinositol 4,5-bisphosphate regulates the actin cytoskeleton.
14550699 2003 Abnormalities in villin gene expression and canalicular microvillus structure in progressive cholestatic liver disease of childhood.
12937273 2003 Villin enhances hepatocyte growth factor-induced actin cytoskeleton remodeling in epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445810 2002 Validation and quantitation of an in vitro M-cell model.
12269817 2002 Regulation of actin dynamics by tyrosine phosphorylation: identification of tyrosine phosphorylation sites within the actin-severing domain of villin.
11500485 2001 Tyrosine phosphorylation of villin regulates the organization of the actin cytoskeleton.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6893424 1980 Villin is a major protein of the microvillus cytoskeleton which binds both G and F actin in a calcium-dependent manner.
3793760 1987 Tropomyosin distinguishes between the two actin-binding sites of villin and affects actin-binding properties of other brush border proteins.
3510866 1986 Isolation of a domain of villin retaining calcium-dependent interaction with G-actin, but devoid of F-actin fragmenting activity.
3453110 1986 A human villin cDNA clone to investigate the differentiation of intestinal and kidney cells in vivo and in culture.
3087992 1986 Different calcium dependence of the capping and cutting activities of villin.
2892781 1988 Localization of the villin gene on human chromosome 2q35-q36 and on mouse chromosome 1.
2846586 1988 Sequence of human villin: a large duplicated domain homologous with other actin-severing proteins and a unique small carboxy-terminal domain related to villin specificity.
1961750 1991 Structure of the human villin gene.