Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.67
PubTator Score 5.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
psoriasis 6694 7.7e-24
acute quadriplegic myopathy 1158 2.7e-03
Disease Target Count Z-score Confidence
Spindle cell sarcoma 2 4.034 2.0
Rhabdomyosarcoma 39 3.433 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.070 2.7e-03
psoriasis -1.900 7.7e-24

Gene RIF (3)

AA Sequence

MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSP      1 - 70
EKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRS     71 - 140
FPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYAL    141 - 210
GGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAW    211 - 280
AGPGGPFASPSGDVAQGLGLSVDSARRYSLCGASLLS                                     281 - 317
//

Text Mined References (13)

PMID Year Title