Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.20
PubTator Score 5.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
psoriasis 6685 7.7e-24
acute quadriplegic myopathy 1157 2.7e-03
Disease Target Count Z-score Confidence
Rhabdomyosarcoma 29 3.602 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
acute quadriplegic myopathy -1.070 2.7e-03
psoriasis -1.900 7.7e-24

Gene RIF (3)

PMID Text
26501226 Identify novel and recurrent VGLL2-related fusions in pediatric spindle and sclerosing rhabdomyosarcomas.
14762206 VITO-1 is a crucial new cofactor of the muscle regulatory programme
12376544 role in promoting skeletal muscle differention

AA Sequence

MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSP      1 - 70
EKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRS     71 - 140
FPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYAL    141 - 210
GGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAW    211 - 280
AGPGGPFASPSGDVAQGLGLSVDSARRYSLCGASLLS                                     281 - 317
//

Text Mined References (13)

PMID Year Title
26501226 2016 A Molecular Study of Pediatric Spindle and Sclerosing Rhabdomyosarcoma: Identification of Novel and Recurrent VGLL2-related Fusions in Infantile Cases.
25416956 2014 A proteome-scale map of the human interactome network.
22218741 2012 Genotype-phenotype correlation in interstitial 6q deletions: a report of 12 new cases.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14762206 2004 VITO-1 is an essential cofactor of TEF1-dependent muscle-specific gene regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14516696 2002 VITO-1, a novel vestigial related protein is predominantly expressed in the skeletal muscle lineage.
12617818 2002 VITO-1, a novel vestigial related protein is predominantly expressed in the skeletal muscle lineage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376544 2002 Mammalian vestigial-like 2, a cofactor of TEF-1 and MEF2 transcription factors that promotes skeletal muscle differentiation.