Property Summary

NCBI Gene PubMed Count 27
PubMed Score 141.15
PubTator Score 69.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Gastric ulcer 34
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.4e-07
lung cancer 4473 7.7e-04
pilocytic astrocytoma 3086 7.4e-03
Disease Target Count Z-score Confidence
Obesity 616 3.027 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma -1.600 1.4e-07
lung cancer 1.100 7.7e-04
pilocytic astrocytoma 1.300 7.4e-03

 GO Function (1)

Gene RIF (21)

PMID Text
26562304 Data show that two VGF peptides (NAPP-19 and QQET-30) were identified in plasma.
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
26142708 Data indicate an increased number of neurosecretory protein VGF-expressing T cells in patients with Alzheimer's disease (AD) compared to aged healthy controls.
25675362 Knock-in mice expressing human VGF were fertile, had increased body weight, whereas those with c-terminal region deletion had reduced adiposity, increased energy expenditure, and improved glucose tolerance.
25569790 Results indicate that neuron-restrictive silencer factor plays an important role as a repressor of VGF gene regulation in neuroblastoma cells through a mechanism that is dependent on VGF-neuron-restrictive silencer element
25529453 NERPs may be potent endogenous suppressors of glucose-dependent insulin secretion.
25013207 We conclude that VGF contributes to survival and function of peripheral T cells
24934694 DISC1 knockdown leads to a reduction of VGF in neurons.
24830820 Among the 19 genes tested, VGF was found to be completely methylated in several Urothelial Cell Carcinoma cell lines
24086249 results indicate that VGF and PGP9.5 PH are potential biomarkers for ovarian carcinoma
22808091 The expression of NPY and VGF was increased in the arcuate nucleus, but decreased in the nucleus of the Tractus Solitarius in the brains of type-II diabetic patients.
21621608 [review] The vgf gene is induced in vivo by neurotrophins including nerve growth factor (NGF), brain derived growth factor (BDNF) and glial derived growth actor (GDNF), by synaptic activity and by homeostatic and other stimuli.
21151573 VGF is regulated by SOD1 and plays a critical role in motor neuron survival
20631166 VGF is downregulated in bipolar disorder in the CA region of the hippocampus and Brodmann's area 9 of the prefrontal cortex.
20471433 localization of neuroendocrine regulatory peptide-1 and-2 (NERP-1 and NERP-2); results suggest that neuroendocrine NERP-1 and NERP-2 might function as local modulatorsin the neuroendocrine system
20164831 VGF mRNA levels were significantly reduced in drug-free depressed patients, as compared with controls, and were modulated in response to effective antidepressant treatment.
19598235 Observational study of gene-disease association. (HuGE Navigator)
18432310 while Vgf may be a reliable biomarker of progression of muscle weakness in patients with ALS, restoration of Vgf expression in spinal cord motor neurons may therapeutically rescue spinal cord motorneurons against excitotoxic injury
17684500 Observational study of gene-disease association. (HuGE Navigator)
17440014 proVGF-related peptides are present in endocrine cells early during development and adulthood and increase in hyperplasia and tumors
16481598 Application of neurosecretory protein VGF biomarker model to current diagnostic criteria provides an objective biomarker pattern that identifies patients with amyotrophic lateral sclerosis.

AA Sequence

MKALRLSASALFCLLLINGLGAAPPGRPEAQPPPLSSEHKEPVAGDAVPGPKDGSAPEVRGARNSEPQDE      1 - 70
GELFQGVDPRALAAVLLQALDRPASPPAPSGSQQGPEEEAAEALLTETVRSQTHSLPAPESPEPAAPPRP     71 - 140
QTPENGPEASDPSEELEALASLLQELRDFSPSSAKRQQETAAAETETRTHTLTRVNLESPGPERVWRASW    141 - 210
GEFQARVPERAPLPPPAPSQFQARMPDSGPLPETHKFGEGVSSPKTHLGEALAPLSKAYQGVAAPFPKAR    211 - 280
RPESALLGGSEAGERLLQQGLAQVEAGRRQAEATRQAAAQEERLADLASDLLLQYLLQGGARQRGLGGRG    281 - 350
LQEAAEERESAREEEEAEQERRGGEERVGEEDEEAAEAEAEAEEAERARQNALLFAEEEDGEAGAEDKRS    351 - 420
QEETPGHRRKEAEGTEEGGEEEDDEEMDPQTIDSLIELSTKLHLPADDVVSIIEEVEEKRKRKKNAPPEP    421 - 490
VPPPRAAPAPTHVRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSA    491 - 560
LRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHVLLRRP                   561 - 615
//

Text Mined References (32)

PMID Year Title
26562304 2015 VGF Peptide Profiles in Type 2 Diabetic Patients' Plasma and in Obese Mice.
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
26142708 2015 VGF expression by T lymphocytes in patients with Alzheimer's disease.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25675362 2015 Role of VGF-derived carboxy-terminal peptides in energy balance and reproduction: analysis of "humanized" knockin mice expressing full-length or truncated VGF.
25569790 2015 Transcriptional regulation of the neuropeptide VGF by the neuron-restrictive silencer factor/neuron-restrictive silencer element.
25529453 2015 Chronic effects of neuroendocrine regulatory peptide (NERP-1 and -2) on insulin secretion and gene expression in pancreatic ?-cells.
25013207 2014 Age-related increase of VGF-expression in T lymphocytes.
24934694 2014 Neuropeptide precursor VGF is genetically associated with social anhedonia and underrepresented in the brain of major mental illness: its downregulation by DISC1.
24830820 2014 Epigenetic inactivation of VGF associated with Urothelial Cell Carcinoma and its potential as a non-invasive biomarker using urine.
24086249 2013 Association of promoter methylation of VGF and PGP9.5 with ovarian cancer progression.
23250050 2013 Large-scale identification of endogenous secretory peptides using electron transfer dissociation mass spectrometry.
22808091 2012 NPY and VGF immunoreactivity increased in the arcuate nucleus, but decreased in the nucleus of the Tractus Solitarius, of type-II diabetic patients.
21621608 2011 VGF: an inducible gene product, precursor of a diverse array of neuro-endocrine peptides and tissue-specific disease biomarkers.
21151573 2010 An inducer of VGF protects cells against ER stress-induced cell death and prolongs survival in the mutant SOD1 animal models of familial ALS.
20631166 2010 The neuropeptide VGF is reduced in human bipolar postmortem brain and contributes to some of the behavioral and molecular effects of lithium.
20471433 2010 Localization of neuroendocrine regulatory peptide-1 and-2 in human tissues.
20164831 2010 The expression of VGF is reduced in leukocytes of depressed patients and it is restored by effective antidepressant treatment.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19194657 2009 Neuroendocrine regulatory peptide-1 and -2: novel bioactive peptides processed from VGF.
18432310 2008 Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis.
17684500 2008 Replication of linkage on chromosome 7q22 and association of the regional Reelin gene with working memory in schizophrenia families.
17440014 2007 Peptide products of the neurotrophin-inducible gene vgf are produced in human neuroendocrine cells from early development and increase in hyperplasia and neoplasia.
16481598 2006 Identification of potential CSF biomarkers in ALS.
15706611 2005 Human cerebrospinal fluid peptidomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10381005 1999 Staurosporine enhances cAMP-induced expression of neural-specific gene VGF and tyrosine hydroxylase.
9344675 1997 Cloning, structural organization analysis, and chromosomal assignment of the human gene for the neurosecretory protein VGF.
9084409 1997 Molecular cloning and characterization of the human VGF promoter region.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.