Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.20
PubTator Score 5.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -2.023 2.3e-02
adult high grade glioma 1.600 4.1e-04
atypical teratoid / rhabdoid tumor 1.900 7.7e-03
Breast cancer -1.100 8.0e-07
cystic fibrosis 3.598 1.3e-07
glioblastoma 1.200 1.2e-03
intraductal papillary-mucinous adenoma (... -2.700 5.5e-05
intraductal papillary-mucinous carcinoma... -2.800 1.0e-04
lung adenocarcinoma -1.600 6.7e-06
lung carcinoma -2.700 2.8e-21
non-small cell lung cancer -1.469 1.5e-19
osteosarcoma -2.545 3.1e-05
pancreatic cancer 1.200 6.6e-05
pancreatic carcinoma 1.200 6.6e-05
pituitary cancer -1.700 1.2e-04

Gene RIF (6)

AA Sequence

MHQLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEICITRITTAIR      1 - 70
ETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRG     71 - 140
NKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTMLLRVLPAVYEKQPQPINRHLTELLALMSQL    141 - 210
EQPEQYHLLRLLHVAAKKKQLEVVQKCIPFLIGHLKDSTHNDIILNILIEIAVYEPVALNSFLPMLKEIG    211 - 280
ERFPYLTGQMARIYGAVGHVDEERARSCLTYLVSQLANMEHSFHHILLLEIKSITDTFSSILGPQSRDIF    281 - 350
RMSNSFTAIAKLLTRQLENTKAGSGRRKISTEIEFPEKLEETKLIVTENEDHEKLQVKIQAFEDKINAGS    351 - 420
NTPGSIRRYSLGQVSKEERKNIRFNRSKSLAFHTMLTKGVGSDDGEDENRGDIPASISLSEIDPLGQGND    421 - 490
KLPFKTDTERSQLGESSVSYPNIIHIDSENLSETVKENSQEETPETTASPIEYQDKLYLHLKKNLSKVKA    491 - 560
YAMEIGKKIPVPDQCTIEDTVRSCVAKLFFTCSLKGHYCLYSKSSFILISQEPQPWIQIMFLFQQSLFPE    561 - 630
PLSIQSHSVQFLRALWEKTQAGGAHSFETAMMESTFPQQKDLDQVQLHLEEVRFFDVFGFSETAGAWQCF    631 - 700
MCNNPEKATVVNQDGQPLIEGKLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDCPIELSKVQ    701 - 770
SVKAVAKKRRDRSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL           771 - 833
//

Text Mined References (19)

PMID Year Title