Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary


No data available


Accession P0C5K6
Symbols CT18


 Compartment GO Term (0)

AA Sequence

MSPPSSMCSPVPLLAAASGQNRMTQGQHFLQKV                                           1 - 33

Text Mined References (3)

PMID Year Title