Property Summary

NCBI Gene PubMed Count 3,705
PubMed Score 17832.74
PubTator Score 20585.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Age related macular degeneration 84
Macular retinal edema 11
Coronary artery disease 240
Atherosclerosis 275
Asthma 349
psoriasis 6685
ATHEROSCLEROSIS, SUSCEPTIBILITY TO 3
Acute kidney injury 65
Alzheimer's disease 644
Arthritis, Experimental 39
Brain Neoplasms 23
Bronchitis, Chronic 9
Carcinoma, Pancreatic Ductal 19
Cerebral Hemorrhage 27
Choroidal Neovascularization 1
Colonic Neoplasms 126
Complications of Diabetes Mellitus 5
Congenital Heart Defects 37
Contact Dermatitis 80
Corneal Neovascularization 2
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 161
Diabetic Nephropathy 37
Endometrial Neoplasms 50
Epilepsy, Temporal Lobe 23
Erectile dysfunction 10
Gastric ulcer 34
Head and Neck Neoplasms 23
Heart Diseases 42
Heart failure 80
Hemangiosarcoma 18
Hypertension, Portal 3
Hypoxia-Ischemia, Brain 5
Inflammation 109
Learning Disorders 27
Liver Cirrhosis 101
Liver Cirrhosis, Experimental 108
Liver Failure 4
Lung diseases 48
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 1(finding) 2
Memory Disorders 36
Myeloid Leukemia 19
Myocardial Ischemia 169
Myocardial Reperfusion Injury 34
Neoplasm Metastasis 138
Neoplasm Recurrence, Local 23
Neoplasms, Experimental 33
Osteochondrodysplasias 15
Pathologic Neovascularization 6
Precancerous Conditions 69
Prostatic Neoplasms 471
Proteinuria 63
Retinal Diseases 21
Retinal Vein Occlusion 6
Rhabdomyosarcoma 29
Rheumatoid Arthritis 1171
Squamous cell carcinoma 96
Status Epilepticus 85
Thrombotic Microangiopathies 2
glioblastoma 5572
gliosarcoma 19
non-small cell lung carcinoma 413
osteosarcoma 7933
Disease Target Count P-value
posterior fossa group A ependymoma 1511 2.54417454883656E-10
Breast cancer 3099 3.59194036324466E-9
tuberculosis and treatment for 3 months 327 3.0826337998313E-6
hepatocellular carcinoma 550 5.34431119267486E-6
cystic fibrosis 1670 2.01135463011449E-5
ovarian cancer 8492 2.35615095795664E-5
atypical teratoid / rhabdoid tumor 4369 1.36490992159995E-4
pediatric high grade glioma 2712 3.17550481302527E-4
lung adenocarcinoma 2714 3.62861155906881E-4
dermatomyositis 967 3.62987777704862E-4
limb girdle muscular dystrophy 2A 156 4.90200124431164E-4
primary pancreatic ductal adenocarcinoma 1271 0.00700983194308274
mucosa-associated lymphoid tissue lymphoma 480 0.00960208351910422
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0101508825622829
interstitial lung disease 292 0.0136452785251121
Polycystic Ovary Syndrome 335 0.0148319805035461
gastric cancer 436 0.0182545421543118
invasive ductal carcinoma 2950 0.0188709377325337
acute quadriplegic myopathy 1157 0.0189345610096342
pancreatic cancer 2300 0.0190807123579711
chronic rhinosinusitis 512 0.0211597601992729
pancreatic carcinoma 567 0.0318012117227274
Disease Target Count Z-score Confidence
Cancer 2346 7.572 3.8
Kuhnt-Junius degeneration 14 6.347 3.2
Retinopathy of prematurity 21 5.762 2.9
Hypertension 293 5.412 2.7
Peripheral vascular disease 90 5.381 2.7
Keratitis 42 5.203 2.6
diabetes mellitus 1663 5.144 2.6
Blindness 84 5.128 2.6
POEMS syndrome 6 4.85 2.4
Ovarian hyperstimulation syndrome 15 4.786 2.4
Retinal detachment 33 4.727 2.4
Cerebrovascular disease 231 4.715 2.4
Endometriosis 535 4.682 2.3
Hemangioma 35 4.668 2.3
Arthritis 248 4.482 2.2
Limb ischemia 12 4.401 2.2
Macular holes 9 4.219 2.1
Endophthalmitis 10 4.194 2.1
Lung disease 136 4.175 2.1
Retinal ischemia 5 4.059 2.0
Heart disease 279 4.03 2.0
Cataract 104 3.958 2.0
Brain edema 26 3.916 2.0
Leukostasis 5 3.872 1.9
Glaucoma 135 3.754 1.9
Hyperglycemia 120 3.753 1.9
Osteonecrosis 25 3.725 1.9
Capillary hemangioma 11 3.681 1.8
Adenoma 165 3.638 1.8
Diarrhea 155 3.596 1.8
Polyneuropathy 30 3.493 1.7
Angioid streaks 5 3.447 1.7
Exanthem 39 3.419 1.7
Hypersensitivity reaction type II disease 235 3.419 1.7
Neurodegenerative disease 383 3.411 1.7
Liver disease 219 3.4 1.7
Neuropathy 210 3.352 1.7
Lymphedema 26 3.347 1.7
Portal hypertension 21 3.322 1.7
Collagen disease 25 3.317 1.7
Myopia 99 3.315 1.7
Coats disease 13 3.312 1.7
Anemia 252 3.22 1.6
Neutropenia 78 3.215 1.6
Rubeosis iridis 4 3.199 1.6
Uveitis 103 3.132 1.6
Peripheral artery disease 8 3.122 1.6
Thrombocytopenia 105 3.106 1.6
Hereditary hemorrhagic telangiectasia 14 3.083 1.5
Inflammatory bowel disease 142 3.072 1.5
Impotence 45 3.005 1.5

Expression

See source...

Gene

PANTHER Protein Class (2)

PDB

1FLT   1QTY   1BJ1   1CZ8   1KAT   1KMX   1MJV   1MKG   1MKK   1TZH   1TZI   1VGH   1VPF   1VPP   2FJG   2FJH   2QR0   2VGH   2VPF   3BDY   3P9W   3QTK   3S1B   3S1K   3V2A   4DEQ   4GLN   4GLS   4KZN   4QAF   4WPB   4ZFF   5DN2   5FV1   5FV2   5HHC   5HHD  

  Ortholog (11)

Gene RIF (3803)

PMID Text
27455016 The -1154A or -2578A alleles of the VEGF gene can significantly decrease the risk of EP among Chinese women
27430109 The mean intensity of VEGF staining was statistically significantly higher in melanomas than in benign or dysplastic naevi.
27358128 The action of VEGF and NOS molecules are important mediators of angiogenesis during dental tissue development.
27097314 FGF-2, VEGF-A, and HIV-Tat, may affect the glomerular filtration barrier in HIV+ children through the induction of synergistic changes in Rho-A and Src activity
27067785 The modulatory role of miR-126 on expression of VEGF-A and its tumor suppressive roles were demonstrated for the first time in thyroid cancer
27033444 Novel angiogenic agent COA-Cl induced activation of PGC-1alpha/ERRalpha/VEGF signaling pathway in fibroblasts.
27029009 Suggest that R-Ras regulates angiogenic activities of endothelial cells in part via inhibition of the p38MAPK-HSP27 axis of VEGF signaling.
27001300 VEGF-A effectively stimulateS proliferation, motility, and directed migration of human EA.hy926 cells.
27000664 By simulating the tumor microenvironment, the MV-delivered miR-29a/c significantly suppresses VEGF expression in gastric cancer cells, inhibiting vascular cell growth, metastasis, and tube formation.
26992254 VEGF serum and biliary levels were increased in malignant biliary obstruction patients.
More...

AA Sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIE      1 - 70
YIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQE     71 - 140
KKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTD    141 - 210
SRCKARQLELNERTCRCDKPRR                                                    211 - 232
//

Text Mined References (3707)

PMID Year Title
27455016 2016 [Association of vascular endothelial growth factor gene polymorphisms with ectopic pregnancy among Chinese women].
27430109 2016 Association of vascular endothelial growth factor expression with patohistological parameters of cutaneous melanoma.
27358128 Vascular endothelial growth factor and nitric oxide synthase expression in human tooth germ development.
27097314 2016 Circulating Fibroblast Growth Factor-2, HIV-Tat, and Vascular Endothelial Cell Growth Factor-A in HIV-Infected Children with Renal Disease Activate Rho-A and Src in Cultured Renal Endothelial Cells.
27067785 2016 Interactive role of miR-126 on VEGF-A and progression of papillary and undifferentiated thyroid carcinoma.
27033444 2016 A key role of PGC-1? transcriptional coactivator in production of VEGF by a novel angiogenic agent COA-Cl in cultured human fibroblasts.
27029009 2015 R-Ras Inhibits VEGF-Induced p38MAPK Activation and HSP27 Phosphorylation in Endothelial Cells.
27001300 2016 Role of VEGF-A in angiogenesis promoted by umbilical cord-derived mesenchymal stromal/stem cells: in vitro study.
27000664 2016 Cell-derived microvesicles mediate the delivery of miR-29a/c to suppress angiogenesis in gastric carcinoma.
26992254 2016 Insulin-Like Growth Factor-1 and Vascular Endothelial Growth Factor in Malignant and Benign Biliary Obstructions.
More...