Property Summary

Ligand Count 35
NCBI Gene PubMed Count 4,076
PubMed Score 19076.63
PubTator Score 20585.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Retinal vein occlusion 9 5.972 3.0
Coronary artery disease 268 4.989 2.5
Atherosclerosis 291 4.273 2.1
psoriasis 6694 3.761 3.70811012871799E-4
Asthma 385 3.737 1.9
Acute kidney injury 70 0.0 0.0
Adenocarcinoma 122 0.0 0.0
Alzheimer Disease 83 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Brain Injuries 65 0.0 0.0
Brain Neoplasms 33 0.0 0.0
Bronchitis, Chronic 12 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Carcinoma, Pancreatic Ductal 20 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Cerebral Hemorrhage 42 0.0 0.0
Choroidal Neovascularization 1 0.0 0.0
Clear-cell metastatic renal cell carcinoma 4 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Corneal Neovascularization 13 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Diabetes Complications 6 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetic Nephropathies 37 0.0 0.0
Endometrial Neoplasms 55 0.0 0.0
Epilepsy, Temporal Lobe 23 0.0 0.0
Erectile dysfunction 32 0.0 0.0
Head and Neck Neoplasms 26 0.0 0.0
Heart Defects, Congenital 37 0.0 0.0
Heart Diseases 43 0.0 0.0
Heart failure 162 0.0 0.0
Hemangiosarcoma 18 0.0 0.0
Hypertension, Portal 22 0.0 0.0
Hypoxia-Ischemia, Brain 5 0.0 0.0
Inflammation 120 0.0 0.0
Learning Disorders 29 0.0 0.0
Leukemia, Myeloid 18 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver Failure 73 0.0 0.0
Lung diseases 50 0.0 0.0
MICROVASCULAR COMPLICATIONS OF DIABETES, SUSCEPTIBILITY TO, 1 1 0.0 0.0
Macular Edema 1 0.0 0.0
Memory Disorders 40 0.0 0.0
Myocardial Ischemia 169 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasm Recurrence, Local 37 0.0 0.0
Neoplasms 63 0.0 0.0
Neoplasms, Experimental 40 0.0 0.0
Neovascularization, Pathologic 6 0.0 0.0
Osteochondrodysplasias 72 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Proteinuria 144 0.0 0.0
Retinal Diseases 55 0.0 0.0
Rhabdomyosarcoma 39 0.0 0.0
Spinal Cord Injuries 8 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Thrombotic Microangiopathies 2 0.0 0.0
Urologic Neoplasms 8 0.0 0.0
Uterine Cervical Neoplasms 26 0.0 0.0
glioblastoma 5792 0.0 1.32171850519062E-5
gliosarcoma 18 0.0 0.0
osteosarcoma 7950 0.0 0.00960443770902143
Disease Target Count Z-score Confidence
Cancer 2499 7.607 3.8
Kuhnt-Junius degeneration 14 6.536 3.3
Retinopathy of prematurity 22 5.867 2.9
Hypertension 396 5.444 2.7
Keratitis 62 5.286 2.6
Blindness 88 5.241 2.6
diabetes mellitus 1728 5.233 2.6
POEMS syndrome 6 4.942 2.5
Retinal Detachment 51 4.887 2.4
Cerebrovascular disease 238 4.801 2.4
Ovarian hyperstimulation syndrome 19 4.797 2.4
Endometriosis 540 4.703 2.4
Gastrointestinal system disease 54 4.644 2.3
Hemangioma 69 4.634 2.3
Arthritis 290 4.552 2.3
Limb ischemia 15 4.428 2.2
Endophthalmitis 12 4.351 2.2
Macular holes 11 4.32 2.2
Lung disease 142 4.214 2.1
Retinal ischemia 7 4.183 2.1
Cataract 297 4.121 2.1
Heart disease 306 4.073 2.0
Brain Edema 50 3.956 2.0
Leukostasis 5 3.926 2.0
Glaucoma 239 3.908 2.0
Osteonecrosis 27 3.887 1.9
Hyperglycemia 137 3.842 1.9
Angioid streaks 11 3.784 1.9
Capillary hemangioma 12 3.773 1.9
Adenoma 167 3.672 1.8
Polyneuropathy 64 3.611 1.8
Myopia 176 3.505 1.8
Coats disease 13 3.504 1.8
Telangiectasis 36 3.479 1.7
Hypersensitivity reaction type II disease 253 3.472 1.7
Neurodegenerative disease 414 3.46 1.7
Collagen disease 27 3.427 1.7
Neuropathy 261 3.406 1.7
Portal hypertension 20 3.365 1.7
Lymphedema 42 3.337 1.7
Uveitis 103 3.324 1.7
Hereditary hemorrhagic telangiectasia 13 3.318 1.7
Rubeosis iridis 4 3.316 1.7
Peripheral artery disease 10 3.223 1.6
Anemia 365 3.211 1.6
Proliferative vitreoretinopathy 17 3.192 1.6
Vitreous detachment 10 3.155 1.6
Impotence 46 3.057 1.5
Exanthem 37 3.046 1.5
Synovitis 78 3.013 1.5

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis -1.300 3.7e-04
glioblastoma 1.900 1.3e-05
osteosarcoma 2.012 9.6e-03
acute quadriplegic myopathy -1.094 1.9e-02
adult high grade glioma 1.800 4.2e-03
atypical teratoid / rhabdoid tumor 1.600 8.7e-04
Breast cancer 1.500 3.6e-09
chronic rhinosinusitis -1.350 2.1e-02
cystic fibrosis 1.417 1.2e-05
dermatomyositis -1.100 3.6e-04
ependymoma 2.200 1.2e-02
gastric cancer -1.300 6.7e-03
hepatocellular carcinoma -1.800 5.3e-06
interstitial lung disease -1.600 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.700 1.0e-02
invasive ductal carcinoma 1.200 1.9e-02
limb girdle muscular dystrophy 2A -1.447 4.9e-04
lung adenocarcinoma 1.200 3.6e-04
mucosa-associated lymphoid tissue lympho... 1.040 9.6e-03
ovarian cancer 2.900 2.4e-05
pancreatic cancer -1.400 3.2e-02
pancreatic carcinoma -1.400 3.2e-02
Polycystic ovary syndrome -1.303 1.5e-02
primary pancreatic ductal adenocarcinoma 1.890 7.0e-03
tuberculosis -2.500 7.1e-05
See source...

Protein-protein Interaction (2)

Gene RIF (4174)

AA Sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIE      1 - 70
YIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQE     71 - 140
KKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTD    141 - 210
SRCKARQLELNERTCRCDKPRR                                                    211 - 232
//

Text Mined References (4080)

PMID Year Title