Property Summary

NCBI Gene PubMed Count 50
PubMed Score 78.05
PubTator Score 45.88

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (24)

AA Sequence

MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLE      1 - 70
TKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDV     71 - 140
DFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVC    141 - 210
EDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSIN    211 - 280
AGGHKVGLALELEA                                                            281 - 294
//

Text Mined References (62)

PMID Year Title