Property Summary

NCBI Gene PubMed Count 152
PubMed Score 762.80
PubTator Score 500.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 2.047 3.9e-04
astrocytic glioma -1.300 4.6e-02
osteosarcoma 1.155 2.2e-03
Breast cancer 3.400 2.6e-02
lung adenocarcinoma 1.379 9.4e-09
ovarian cancer 2.800 4.4e-05

Protein-protein Interaction (11)

Gene RIF (97)

PMID Text
27080741 Reducing VDAC1 expression induces a non-apoptotic role for pro-apoptotic proteins in glioblastoma multiforme cancer cell differentiation.
26947058 The works available on VDAC cysteines support the notion that VDAC1, VDAC2, and VDAC3 proteins are paralogs with a similar pore-function and slightly different, but important, ancillary biological functions. (Review)
26801612 The protective effect of miR-7 is partly exerted through promoting mitochondrial function by targeting VDAC1 expression.
26716410 High VDAC1 expression is associated with cervical cancer.
26655341 Data show that voltage-dependent anion channel 1 (VDAC1) knockout cells are resistant to AMP-activated protein kinase (AMPK) and mechanistic target of rapamycin (mTOR) modulation by itraconazole, indicating VDAC1 is the mediator of the activity.
26646027 findings also suggest that VDAC1 may be a novel biomarker for gastric cancer
26542804 Amyloid beta -mediated toxicity involves mitochondrial and plasma membrane VDAC1, leading to mitochondrial dysfunction and apoptosis induction.
26472185 serum starvation induces CREB1 expression, in turn activating miR-320a expression, which then down-regulates VDAC1 expression to facilitate mitophagy
26462148 Studies using B16F10 and A375 cells genetically modified for ATF2 indicated that mitochondrial ATF2 was able to dissociate Bim from the Mcl-1/Bim complex to trigger VDAC1 oligomerization.
26191154 PGC-1alpha deficiency exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1.
26055708 The functional interactions between VDAC and alpha-syn, revealed by the present study, point toward the long sought after physiological and pathophysiological roles for monomeric alpha-syn in PD and in other alpha-synucleinopathies
25874870 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells
25691661 TP53 regulation of VDAC1 cleavage occurs through mitochondrial Mieap and is dependent on the endolysosomal pH.
25681439 data indicate that the BH4 domain of Bcl-XL, but not that of Bcl-2, selectively targets VDAC1 and inhibits apoptosis by decreasing VDAC1-mediated Ca(2+) uptake into the mitochondria
25545271 VDAC1 was expressed and reconstituted into two-dimensional lipid crystalline bilayers with characteristics identical to wild type samples.
25502766 The serum lever of Alzheimer's disease were increase and the expression of VDAC1 strongly correlated with the Mini-Mental State Examination scores of the AD patients.
25459681 Data indicate that curcumin interacts with residues in the alpha helical N-terminus of voltage dependent anion channel VDAC-1 and in the channel wall.
25448878 VDAC1 is involved in the process of mitochondria-mediated apoptosis by mediating the release of apoptotic proteins and interacting with anti-apoptotic proteins. (Review)
25436615 Results show that BNIP3 interacts with the voltage-dependent anion channel (VDAC) to directly induce mitochondrial release and nuclear translocation of EndoG.
25341036 These data suggest that an interaction between Mcl-1 and VDAC promotes lung cancer cell migration by a mechanism that involves Ca(2+)-dependent reactive oxygen species production.
25296756 Data indicate that voltage-dependent anion channel 1 (VDAC1) is involved in plasminogen kringle 5 (K5)-induced activation of the mitochondrial apoptosis pathway.
24886575 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells
24825319 Results indicate that mitochondrial function associated with VDAC1 is decreased in sporadic and experimental Parkinson's disease, and this decrease is associated with alpha-synuclein accumulation and aggregation
24728177 Voltage-dependent structural changes of hVDAC1
24704533 Ca(2+)-mediated regulation of VDAC1 expression levels is associated with cell death induction.
24668813 Nucleotide interactions of the human voltage-dependent anion channel.
24324700 the C-terminus end of VDAC faces the mitochondrial inter-membrane space.
24272356 This review examines the significance of this new form of VDAC1 for anticancer therapy.[review]
24211404 Label-free quantitative comparison of DN urinary exosomes vs control group and SRM further validation, resulted in the discovery of a panel of three proteins (AMBP, MLL3 and VDAC1) which changes in DN.
24063855 Increase in mRNA levels of the voltage-dependent anion channel 1 gene is associated with Alzheimer's disease.
23874603 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells
23161549 VDAC binds tissue-type plasminogen activator (t-PA) on human neuroblastoma SK-N-SH cells
23060438 VDAC 1, 2, and 3 recruit Parkin to defective mitochondria to promote mitochondrial autophagy.
22926141 Abnormal interaction of VDAC1 with amyloid beta and phosphorylated tau causes mitochondrial dysfunction in Alzheimer's disease.
22841291 The N-terminal helix of VDAC1 controls entry into elliptic beta-barrel states which underlie VDAC closure.
22616995 PBR can inhibit endothelial activation through inhibition of mitochondrial ROS and/or VDAC-1 expression in endothelial cells
22589539 Interfering with Bcl-xL binding to the mitochondria by VDAC1-based peptides may serve to induce apoptosis in cancer cells.
22435461 analysis of lipid dynamics and protein-lipid interactions in 2D crystals formed with the beta-barrel integral membrane protein VDAC1
22397371 A single cysteine-residue-bearing VDAC1 demonstrates that the N-terminal region lies inside the channel pore.
22389449 hypoxia induces the appearance of a C-terminal truncated form of VDAC1
22325275 specific lipid composition of the outer mitochondrial membrane might be of crucial relevance and, thus, a potential cue for regulating the oligomeric state of VDAC
22315232 VDAC1 and CNTNAP1 associate with gamma-secretase in detergent-resistant membranes and affect amyloid precursor protein processing.
22190034 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells
22164227 there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization
22159995 VDAC is the ATP conduit in the IP receptor-mediated signaling pathway in human erythrocytes.
22117062 Dissection of VDAC1 dimerization/oligomerization as presented here provides structural insight into the oligomeric status of cellular VDAC1 under physiological and apoptotic conditions.
21720385 VDAC1 silencing potentiates apoptotic challenges.
21442216 Considering the ubiquitous expression modus of APP, beta- and gamma-secretases and type-1 VDAC/eukaryotic porin a basic model of apoptosis might be given.
21281575 Canonical Monte Carlo/Brownian dynamics (GCMC/BD) simulations to explore the ion transport properties of human VDAC isoform 1 (hVDAC1; PDB:2K4T) embedded in an implicit membrane.
21281574 A total of 1.77 mus molecular dynamics simulations of human VDAC isoform 1, was performed.
21148773 Results imply that micro- to millisecond dynamics in the N-terminal part of the barrel are essential for VDAC interaction and gating.
20937774 Data suggest that VDAC1 oligomerization is involved in mitochondrion-mediated apoptosis and may represent a general mechanism common to numerous apoptogens acting via different initiating cascades.
20890124 Mitochondria are aggregated by p62, following its recruitment by Parkin in a VDAC1-independent manner.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20846459 VDAC1 expression was not altered cervical neoplasms.
20435015 describe the crystallization of voltage-dependent anion channel-1 produced by a bacterial cell-free expression system
20434446 The substitution of the VDAC3 N-terminus with the VDAC1 N-terminus caused the chimaera to become more active than VDAC1.
20404552 The results of this study demonstrate, for the first time, the anticancer therapeutic potential of VDAC1 downregulation by means of shRNA.
20347420 FimA strengthens the VDAC1-hexokinase interaction and prevents dissociation of hexokinase from VDAC1 triggered by apoptotic stimuli.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20230784 these data provide a mechanism to explain how Nek1 regulates cell death by affecting the opening and closing of VDAC1.
20192921 Data suggest that the two cysteine residues are not required for apoptosis or VDAC1 oligomerization.
20132430 H. pylori VacA p58 (vacuolating cytotoxin A p58 domain) induced apoptosis in gastric epithelial carcinoma cells and was associated with the up-regulation of Bax/VDAC1 (voltage-dependent anion channel 1) and the downregulation of Bcl-2
20117113 The length of the tag at the C-terminus is critical for the assembly of VDAC1, as well as the amino acid residues at positions 130, 222, 225 and 251 of the protein.
20098416 Data identified VDAC1 (voltage-dependent anion channel 1) as a target for Parkin-mediated Lys 27 poly-ubiquitylation and mitophagy.
19717555 a VDAC1-containing mitochondrial system is involved in PQ poisoning
19669810 The dynamics of the molecular interactions between the C-terminal region of PB1-F2 protein and VDAC1 and ANT3 were expounded by employing an in silico approach.
19668262 Our data thus support a model of the PTP complex involving VDAC1 at the MOM, and indicate that VDAC1-dependent MPT is an upstream mechanism playing a causal role in oxidative stress-induced apoptosis.
19595769 Data demonstrate in caveolae of human cortex and hippocampus the presence of pl-VDAC and ERalpha, in a complex with scaffolding caveolin-1 which likely provides ERalpha stability at the plasma membrane.
19094960 Displacing hexokinase from its binding site on VDAC1 may be exploited as an approach to cancer therapy.
19049977 results point to HK-I and HK-II as promoting tumor cell survival through binding to VDAC1, thereby inhibiting cytochrome c release and apoptotic cell death.
18832158 the 3D structure of human VDAC1, which was solved conjointly by NMR spectroscopy and x-ray crystallography
18755977 study presents NMR solution structure of recombinant VDAC-1 reconstituted in detergent micelles
18690523 Approaching the structure of human VDAC1, a key molecule in mitochondrial cross-talk.
18607100 High-resolution structure analysis of human VDAC1 crystal lattice reveals that it belongs to trigonal space group P321, with unit-cell parameters a = 78.9, c = 165.7 A and one monomer in the asymmetric unit.
18568384 Human voltage-dependent anion selective channel 1 is a target antigen for anti-glomerular endothelial cell antibody in mixed connective tissue disease.
18381814 two serine residues of VDAC1, Ser-12 and Ser-103, can modulate VDAC1 protein level and thus the sensitivity to apoptosis stimuli
18362892 VDAC1 may act as a facultative regulator/effector of MMP, depending on the initial cytotoxic event.
18308720 interference with the binding of Hexokinase-I to mitochondria by VDAC1-derived peptides may offer a novel strategy by which to potentiate the efficacy of conventional chemotherapeutic agents
18250166 phosphorylated StAR interacts with voltage-dependent anion channel 1 (VDAC1) on the OMM, which then facilitates processing of the 37-kDa phospho-StAR to the 32-kDa intermediate.
17828567 Our analysis strongly suggests a 16-stranded, antiparallel beta-barrel with one large and seven short loops and turns. Initial crystallization trials of the protein yielded crystals diffracting to 8 Angstrom resolution.
17336328 hVDAC1 formed different structures in detergent micelles and phospholipid bilayers.
17254575 gelsolin G5 domain inhibits HIV-Vpr-induced T-cell apoptosis by blocking the interaction between Vpr and VDAC
17254575 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells
17209561 Bcl-xL can bind to one or two VDAC1 molecules forming heterodimers and heterotrimers.
16585511 VDAC1 regulates apoptosis independent of the apoptosis-inducing pathway.
16185087 evidences of VDAC-COX interaction in vitro proved to be functional as evidenced by the effect of the human and yeast isoforms of VDAC on the oxidation of cytochrome c by the pure holoenzyme and by the effect of the COX epitope on VDAC permeability
15630200 a model on how electron transport may occur in VDAC1.
14647451 VDAC homodimerization could potentially determine its gating capacity to cyto c, and Bcl-2 blockage of VDAC homodimerization represents a novel mechanism for its inhibition of apoptosis.
14573604 a major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis
12767928 Identification of the protein-protein contact site and interaction mode of VDAC1 with Bcl-2 family proteins.
12736244 is a receptor for plasminogen kringle 5 on endothelial cells
12698369 Presence of a plasma membrane VDAC was demonstrated. Colocalisation of VDAC with caveolin-1.
12118373 Activation of mitochondrial voltage-dependent anion channel by apro-apoptotic protein Bim
12009301 interacts with the dynein light chain Tctex1 and the heat-shock protein PBP74; results of this study represent additional evidence of membrane-associated trafficking of the voltage-dependent anion-selective channel 1
11181702 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells
10620603 HIV-1 Nef downregulates the expression of voltage-dependent anion channel 1 (VDAC1) protein in Nef-transfected SupT1 cells

AA Sequence

MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLT      1 - 70
FTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRG     71 - 140
ALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAW    141 - 210
TAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE    211 - 280
FQA                                                                       281 - 283
//

Text Mined References (168)

PMID Year Title
27080741 2016 Reducing VDAC1 expression induces a non-apoptotic role for pro-apoptotic proteins in cancer cell differentiation.
26947058 2016 Role of cysteines in mammalian VDAC isoforms' function.
26801612 2016 MicroRNA-7 Regulates the Function of Mitochondrial Permeability Transition Pore by Targeting VDAC1 Expression.
26716410 2016 Clinical implication of voltage-dependent anion channel 1 in uterine cervical cancer and its action on cervical cancer cells.
26655341 2015 Antifungal drug itraconazole targets VDAC1 to modulate the AMPK/mTOR signaling axis in endothelial cells.
26646027 2015 Mitochondrial Proteomics Approach Reveals Voltage-Dependent Anion Channel 1 (VDAC1) as a Potential Biomarker of Gastric Cancer.
26542804 2015 The Voltage-dependent Anion Channel 1 Mediates Amyloid ? Toxicity and Represents a Potential Target for Alzheimer Disease Therapy.
26472185 2015 CREB1-driven expression of miR-320a promotes mitophagy by down-regulating VDAC1 expression during serum starvation in cervical cancer cells.
26462148 2015 Mitochondrial ATF2 translocation contributes to apoptosis induction and BRAF inhibitor resistance in melanoma through the interaction of Bim with VDAC1.
26191154 2015 Lack of PGC-1? exacerbates high glucose-induced apoptosis in human umbilical vein endothelial cells through activation of VADC1.
26055708 2015 ?-Synuclein Shows High Affinity Interaction with Voltage-dependent Anion Channel, Suggesting Mechanisms of Mitochondrial Regulation and Toxicity in Parkinson Disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25691661 2015 Local mitochondrial-endolysosomal microfusion cleaves voltage-dependent anion channel 1 to promote survival in hypoxia.
25681439 2015 The BH4 domain of anti-apoptotic Bcl-XL, but not that of the related Bcl-2, limits the voltage-dependent anion channel 1 (VDAC1)-mediated transfer of pro-apoptotic Ca2+ signals to mitochondria.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25545271 2015 Magic angle spinning nuclear magnetic resonance characterization of voltage-dependent anion channel gating in two-dimensional lipid crystalline bilayers.
25502766 2015 Translational study of Alzheimer's disease (AD) biomarkers from brain tissues in A?PP/PS1 mice and serum of AD patients.
25459681 2015 Modulation of the mitochondrial voltage dependent anion channel (VDAC) by curcumin.
25448878 2015 The mitochondrial voltage-dependent anion channel 1 in tumor cells.
25436615 2014 The proapoptotic protein BNIP3 interacts with VDAC to induce mitochondrial release of endonuclease G.
25341036 2014 Mcl-1 promotes lung cancer cell migration by directly interacting with VDAC to increase mitochondrial Ca2+ uptake and reactive oxygen species generation.
25296756 2014 Plasminogen kringle 5 induces endothelial cell apoptosis by triggering a voltage-dependent anion channel 1 (VDAC1) positive feedback loop.
25244949 2014 Hepatitis C virus core protein suppresses mitophagy by interacting with parkin in the context of mitochondrial depolarization.
25168729 2014 A? promotes VDAC1 channel dephosphorylation in neuronal lipid rafts. Relevance to the mechanisms of neurotoxicity in Alzheimer's disease.
24947355 2014 Mitochondria-associated endoplasmic reticulum membrane (MAM) integrity is required for insulin signaling and is implicated in hepatic insulin resistance.
24825319 2014 Abnormal alpha-synuclein reduces nigral voltage-dependent anion channel 1 in sporadic and experimental Parkinson's disease.
24728177 2014 Voltage-dependent structural changes of the membrane-bound anion channel hVDAC1 probed by SEIRA and electrochemical impedance spectroscopy.
24704533 2014 Ca(2+)-mediated regulation of VDAC1 expression levels is associated with cell death induction.
24668813 2014 Nucleotide interactions of the human voltage-dependent anion channel.
24324700 2013 The voltage-dependent anion selective channel 1 (VDAC1) topography in the mitochondrial outer membrane as detected in intact cell.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24272356 2014 Hypoxic VDAC1: a potential mitochondrial marker for cancer therapy.
24211404 2014 Diabetic nephropathy induces changes in the proteome of human urinary exosomes as revealed by label-free comparative analysis.
24063855 2013 RNA silencing of genes involved in Alzheimer's disease enhances mitochondrial function and synaptic activity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161549 2013 The voltage-dependent anion channel (VDAC) binds tissue-type plasminogen activator and promotes activation of plasminogen on the cell surface.
23060438 2012 Voltage-dependent anion channels (VDACs) recruit Parkin to defective mitochondria to promote mitochondrial autophagy.
23055042 2012 Human Bop is a novel BH3-only member of the Bcl-2 protein family.
22926141 2012 Abnormal interaction of VDAC1 with amyloid beta and phosphorylated tau causes mitochondrial dysfunction in Alzheimer's disease.
22841291 2012 ?-Barrel mobility underlies closure of the voltage-dependent anion channel.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22616995 2012 Peripheral benzodiazepine receptor regulates vascular endothelial activations via suppression of the voltage-dependent anion channel-1.
22589539 2012 Mediation of the antiapoptotic activity of Bcl-xL protein upon interaction with VDAC1 protein.
22435461 2012 Lipid dynamics and protein-lipid interactions in 2D crystals formed with the ?-barrel integral membrane protein VDAC1.
22397371 2012 Structure-based analysis of VDAC1: N-terminus location, translocation, channel gating and association with anti-apoptotic proteins.
22389449 2012 Expression of a truncated active form of VDAC1 in lung cancer associates with hypoxic cell survival and correlates with progression to chemotherapy resistance.
22325275 2012 The role of lipids in VDAC oligomerization.
22315232 2012 Identification of novel ?-secretase-associated proteins in detergent-resistant membranes from brain.
22304920 2012 PKC? promotes oncogenic functions of ATF2 in the nucleus while blocking its apoptotic function at mitochondria.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22164227 2011 MAP4 mechanism that stabilizes mitochondrial permeability transition in hypoxia: microtubule enhancement and DYNLT1 interaction with VDAC1.
22159995 2012 Prostacyclin receptor-mediated ATP release from erythrocytes requires the voltage-dependent anion channel.
22117062 2012 Structure-based analysis of VDAC1 protein: defining oligomer contact sites.
21720385 2012 VDAC1 selectively transfers apoptotic Ca2+ signals to mitochondria.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21442216 2011 Apoptogenic interactions of plasmalemmal type-1 VDAC and A? peptides via GxxxG motifs induce Alzheimer's disease - a basic model of apoptosis?
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21370995 2011 Expression of leucine-rich repeat kinase 2 (LRRK2) inhibits the processing of uMtCK to induce cell death in a cell culture model system.
21281575 2011 Brownian dynamics simulations of ion transport through the VDAC.
21281574 2011 Molecular dynamics studies of ion permeation in VDAC.
21269460 2011 Initial characterization of the human central proteome.
21156174 2011 Biphasic effect of nitric oxide on the cardiac voltage-dependent anion channel.
21148773 2010 Functional dynamics in the voltage-dependent anion channel.
20937774 2010 Oligomerization of the mitochondrial protein voltage-dependent anion channel is coupled to the induction of apoptosis.
20890124 2010 p62/SQSTM1 is required for Parkin-induced mitochondrial clustering but not mitophagy; VDAC1 is dispensable for both.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20846459 2010 A study of association between expression of hOGG1, VDAC1, HK-2 and cervical carcinoma.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20435015 2010 Crystallization of the membrane protein hVDAC1 produced in cell-free system.
20434446 2010 Swapping of the N-terminus of VDAC1 with VDAC3 restores full activity of the channel and confers anti-aging features to the cell.
20404552 2010 Downregulation of voltage-dependent anion channel-1 expression by RNA interference prevents cancer cell growth in vivo.
20347420 2010 A soluble form of the pilus protein FimA targets the VDAC-hexokinase complex at mitochondria to suppress host cell apoptosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20230784 2010 Phosphorylation by Nek1 regulates opening and closing of voltage dependent anion channel 1.
20192921 2010 VDAC1 cysteine residues: topology and function in channel activity and apoptosis.
20132430 2010 Involvement of VDAC1 and Bcl-2 family of proteins in VacA-induced cytochrome c release and apoptosis of gastric epithelial carcinoma cells.
20117113 2010 A tag at the carboxy terminus prevents membrane integration of VDAC1 in mammalian mitochondria.
20098416 2010 PINK1/Parkin-mediated mitophagy is dependent on VDAC1 and p62/SQSTM1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19717555 2009 Paraquat toxicity induced by voltage-dependent anion channel 1 acts as an NADH-dependent oxidoreductase.
19669810 2010 Molecular interactions between mitochondrial membrane proteins and the C-terminal domain of PB1-F2: an in silico approach.
19668262 2009 Outer membrane VDAC1 controls permeability transition of the inner mitochondrial membrane in cellulo during stress-induced apoptosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19595769 2009 VDAC and ERalpha interaction in caveolae from human cortex is altered in Alzheimer's disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19094960 2009 Key regions of VDAC1 functioning in apoptosis induction and regulation by hexokinase.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19049977 2009 Voltage-dependent anion channel 1-based peptides interact with hexokinase to prevent its anti-apoptotic activity.
18832158 2008 Structure of the human voltage-dependent anion channel.
18755977 2008 Solution structure of the integral human membrane protein VDAC-1 in detergent micelles.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18690523 2008 Approaching the structure of human VDAC1, a key molecule in mitochondrial cross-talk.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18607100 2008 Crystallization and preliminary X-ray crystallographic studies of human voltage-dependent anion channel isoform I (HVDAC1).
18568384 2008 Human voltage-dependent anion selective channel 1 is a target antigen for antiglomerular endothelial cell antibody in mixed connective tissue disease.
18381814 2008 Voltage-dependent anion channel 1 is involved in endostatin-induced endothelial cell apoptosis.
18362892 2008 Hierarchical involvement of Bak, VDAC1 and Bax in cisplatin-induced cell death.
18308720 2008 Hexokinase-I protection against apoptotic cell death is mediated via interaction with the voltage-dependent anion channel-1: mapping the site of binding.
18250166 2008 Steroidogenic activity of StAR requires contact with mitochondrial VDAC1 and phosphate carrier protein.
18088087 2008 Phosphoproteome of resting human platelets.
18063578 2008 The layered structure of human mitochondrial DNA nucleoids.
17828567 2007 High-level expression, refolding and probing the natural fold of the human voltage-dependent anion channel isoforms I and II.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17336328 2007 Correct folding of the beta-barrel of the human membrane protein VDAC requires a lipid bilayer.
17254575 2007 Gelsolin segment 5 inhibits HIV-induced T-cell apoptosis via Vpr-binding to VDAC.
17209561 2007 NMR structural investigation of the mitochondrial outer membrane protein VDAC and its interaction with antiapoptotic Bcl-xL.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17008324 2006 Mitochondrial functions and estrogen receptor-dependent nuclear translocation of pleiotropic human prohibitin 2.
16585511 2006 The expression level of the voltage-dependent anion channel controls life and death of the cell.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16201016 2005 Influenza virus PB1-F2 protein induces cell death through mitochondrial ANT3 and VDAC1.
16185087 2005 In vitro interactions between the two mitochondrial membrane proteins VDAC and cytochrome c oxidase.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15644312 2005 Dissection of the mitochondrial import and assembly pathway for human Tom40.
15637055 2005 Specific cleavage of Mcl-1 by caspase-3 in tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis in Jurkat leukemia T cells.
15635413 2005 Nucleolar proteome dynamics.
15630200 2004 Characterization of VDAC1 as a plasma membrane NADH-oxidoreductase.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15033708 2003 Study of PTPC composition during apoptosis for identification of viral protein target.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647451 2004 Essential role of the voltage-dependent anion channel (VDAC) in mitochondrial permeability transition pore opening and cytochrome c release induced by arsenic trioxide.
14573604 2004 VDAC1 is a transplasma membrane NADH-ferricyanide reductase.
12767928 2003 Identification of the protein-protein contact site and interaction mode of human VDAC1 with Bcl-2 family proteins.
12736244 2003 The voltage-dependent anion channel is a receptor for plasminogen kringle 5 on human endothelial cells.
12698369 2003 Voltage-dependent anion channel localises to the plasma membrane and peripheral but not perinuclear mitochondria.
12663490 2003 Protein kinase Cepsilon interacts with and inhibits the permeability transition pore in cardiac mitochondria.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12243190 2002 Bax releases cytochrome c preferentially from a complex between porin and adenine nucleotide translocator. Hexokinase activity suppresses this effect.
12118373 2002 Activation of mitochondrial voltage-dependent anion channel by apro-apoptotic BH3-only protein Bim.
12087096 2002 Tubulin is an inherent component of mitochondrial membranes that interacts with the voltage-dependent anion channel.
12009301 2002 Voltage-dependent anion-selective channel (VDAC) interacts with the dynein light chain Tctex1 and the heat-shock protein PBP74.
11845315 2001 Gadolinium as an opener of the outwardly rectifying Cl(-) channel (ORCC). Is there relevance for cystic fibrosis therapy?
11602586 2001 Mitochondrial creatine kinase and mitochondrial outer membrane porin show a direct interaction that is modulated by calcium.
11181702 2001 Control of mitochondrial membrane permeabilization by adenine nucleotide translocator interacting with HIV-1 viral protein rR and Bcl-2.
11091140 2000 Human voltage-dependent anion-selective channel expressed in the plasmalemma of Xenopus laevis oocytes.
11039896 2000 Human gelsolin prevents apoptosis by inhibiting apoptotic mitochondrial changes via closing VDAC.
10978502 2000 Structure of the 5' region of the human hexokinase type I (HKI) gene and identification of an additional testis-specific HKI mRNA.
10772903 2000 Characterization of the human porin isoform 1 (HVDAC1) gene by amplification on the whole human genome: A tool for porin deficiency analysis.
10737788 2000 BH4 domain of antiapoptotic Bcl-2 family members closes voltage-dependent anion channel and inhibits apoptotic mitochondrial changes and cell death.
10661876 1999 Mitochondria-derived and extra-mitochondrial human type-1 porin are identical as revealed by amino acid sequencing and electrophysiological characterisation.
10639121 2000 Proapoptotic BH3-only Bcl-2 family members induce cytochrome c release, but not mitochondrial membrane potential loss, and do not directly modulate voltage-dependent anion channel activity.
10620603 2000 The HIV-1 viral protein R induces apoptosis via a direct effect on the mitochondrial permeability transition pore.
10501981 1999 Revised fine mapping of the human voltage-dependent anion channel loci by radiation hybrid analysis.
10365962 1999 Bcl-2 family proteins regulate the release of apoptogenic cytochrome c by the mitochondrial channel VDAC.
10049775 1999 Mapping of the human Voltage-Dependent Anion Channel isoforms 1 and 2 reconsidered.
9874241 1998 Cyclophilin-D binds strongly to complexes of the voltage-dependent anion channel and the adenine nucleotide translocase to form the permeability transition pore.
9843949 1998 Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria.
9644232 1998 Endosomes: another extra-mitochondrial location of type-1 porin/voltage-dependent anion-selective channels.
9119086 1997 Human mitochondrial import receptor, Tom20p. Use of glutathione to reveal specific interactions between Tom20-glutathione S-transferase and mitochondrial precursor proteins.
8420959 1993 Cloning and functional expression in yeast of two human isoforms of the outer mitochondrial membrane channel, the voltage-dependent anion channel.
7685903 1993 Mapping of residues forming the voltage sensor of the voltage-dependent anion-selective channel.
7539795 1995 Subcellular localization of human voltage-dependent anion channel isoforms.
7525559 1994 In vitro complex formation between the octamer of mitochondrial creatine kinase and porin.
7517385 1994 Human genes encoding the voltage-dependent anion channel (VDAC) of the outer mitochondrial membrane: mapping and identification of two new isoforms.
2559745 1989 [Identification of human porins. II. Characterization and primary structure of a 31-lDa porin from human B lymphocytes (Porin 31HL)].
1657034 1991 Studies on human porin. IV. The primary structures of "Porin 31HM" purified from human skeletal muscle membranes and of "Porin 31HL" derived from human B lymphocyte membranes are identical.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1373486 1992 Isolation of the mitochondrial benzodiazepine receptor: association with the voltage-dependent anion channel and the adenine nucleotide carrier.