Tbio | Voltage-dependent anion-selective channel protein 1 |
Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (PubMed:11845315, PubMed:18755977, PubMed:20230784, PubMed:8420959). May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis (PubMed:15033708, PubMed:25296756).
This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.[provided by RefSeq, Sep 2010]
This gene encodes a voltage-dependent anion channel protein that is a major component of the outer mitochondrial membrane. The encoded protein facilitates the exchange of metabolites and ions across the outer mitochondrial membrane and may regulate mitochondrial functions. This protein also forms channels in the plasma membrane and may be involved in transmembrane electron transport. Alternate splicing results in multiple transcript variants. Multiple pseudogenes of this gene are found on chromosomes 1, 2 3, 6, 9, 12, X and Y.[provided by RefSeq, Sep 2010]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Diabetic Nephropathies | 37 | 0.0 | 0.0 |
Epilepsy | 792 | 0.0 | 0.0 |
Mitochondrial Myopathies | 21 | 0.0 | 0.0 |
Myocardial Infarction | 151 | 0.0 | 0.0 |
Myocardial Reperfusion Injury | 37 | 0.0 | 0.0 |
Psychomotor Disorders | 7 | 0.0 | 0.0 |
Ventricular Dysfunction, Left | 22 | 0.0 | 0.0 |
Disease | Target Count |
---|---|
Diabetic Nephropathy | 34 |
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2716 | 9.4e-09 |
ovarian cancer | 8520 | 4.4e-05 |
Multiple myeloma | 1332 | 3.9e-04 |
osteosarcoma | 7950 | 2.2e-03 |
Breast cancer | 3578 | 2.6e-02 |
astrocytic glioma | 2597 | 4.6e-02 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -1.300 | 4.6e-02 |
Breast cancer | 3.400 | 2.6e-02 |
lung adenocarcinoma | 1.379 | 9.4e-09 |
Multiple myeloma | 2.047 | 3.9e-04 |
osteosarcoma | 1.155 | 2.2e-03 |
ovarian cancer | 2.800 | 4.4e-05 |
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLT 1 - 70 FTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRG 71 - 140 ALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAW 141 - 210 TAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE 211 - 280 FQA 281 - 283 //