Property Summary

NCBI Gene PubMed Count 142
PubMed Score 1981.88
PubTator Score 1025.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.500 2.4e-02
glioblastoma 1.400 3.6e-02
atypical teratoid/rhabdoid tumor 2.000 9.6e-08
tuberculosis 1.600 1.4e-06
pancreatic ductal adenocarcinoma liver m... 1.051 3.9e-02
colon cancer -3.700 2.8e-05
lung cancer -1.100 6.9e-04
diabetes mellitus -1.200 5.4e-03
group 4 medulloblastoma -1.500 3.5e-05
posterior fossa group A ependymoma 1.100 9.9e-07
subependymal giant cell astrocytoma 1.337 2.0e-02
lung carcinoma -1.600 2.3e-19
ovarian cancer 2.100 4.0e-05
axial spondyloarthropathy 1.100 3.7e-03
pancreatic cancer 1.100 6.0e-03

Protein-protein Interaction (10)

Gene RIF (79)

PMID Text
26728462 roles and mechanisms of phospholipids in regulating the structure and function of vinculin and of its muscle-specific metavinculin splice variant.
26650627 Three novel genes were identified as recurrently mutated; MYCN, MYO5B and VCL, and mutations in these genes were exclusively found in malignant sympathetic paraganglioma tumors.
26493222 Upon actin engagement, the N-terminal "strap" and helix 1 are displaced from the vinculin tail helical bundle to mediate actin bundling.
26487440 The VCL-encoding protein was involved in cardiomyopathy that associated with hypertension, therefore our results suggest the rs4746172 of VCL may be a novel target for clinical interventions to reduce CVD risk by regulating blood pressure in male Chinese
26109125 This study defined a plastic relationship between vinculin-mediated tension and adhesion complex area that controls fundamental cell-matrix adhesion properties.
26053221 Data indicate that specific protein interactions are spatially segregated within focal adhesions (FAs) at the nanoscale to regulate vinculin activation and function.
25997717 Analysis showed that ITGB4 and VCL were upregulated in exosomes derived from taxane-resistant prostate cancer cells suggesting them as useful markers for progression of prostate cancer associated with taxane-resistance.
25942574 vinculin, present in the joints of anti-citrullinated protein antibody (ACPA)(+) rheumatoid arthritis patients, was identified as an autoantigen targeted by ACPA and CD4(+) T cells.
25745180 HIV-1 Nef co-localizes with vinvulin inside podosomes in human monocyte-derived macrophages
25527710 HIV-1 Nef co-localizes with vinvulin inside podosomes in human monocyte-derived macrophages
25496021 Vinculin expression was found to be significantly downregulated.
25488920 PIP2 binding is required for the control of vinculin dynamics and turnover in focal adhesions.
25449281 vinculin negatively regulates malignant phenotype of tumor cells including MT1-MMP transcription through MEK/ERK pathway
25298412 Vinculin was identified as a potential plasma biomarker for age-related macular degeneration.
24878663 Our NMR and ITC data indicate that the SH3a and SH3b domains of CAP simultaneously bind to a long proline-rich region of vinculin with different binding specificities
24751539 These data reveal an unexpected regulatory mechanism in which vinculin Y822 phosphorylation determines whether cadherins transmit force and provides a paradigm for how a shared component of adhesions can produce biologically distinct functions.
24698962 Case Report: VCL-ALK gene fusion in renal cell carcinoma in patient with sickle cell trait.
24466349 vinculin binds to Rab5 and is required for Staphylococcus aureus uptake in cells.
24452377 These results indicate that mechanical forces loaded to focal adhesions (FAs) facilitate vinculin binding to talin at FAs.
24452080 The activation of vinculin by stretched talin induces a positive feedback that reinforces the actin-talin-vinculin association.
24446374 Data indicate the role of vinculin in inducing the talin mediated integrin activation.
24369271 Vinculin is a new marker for atherosclerosis.
24219282 p38 mitogen-activated protein kinase interacts with vinculin at focal adhesions during fatty acid-stimulated cell adhesion.
23687380 this study elucidated how tensile forces generated by single stress fibers are temporally and spatially distributed to vinculin mechanosensors located within cell-matrix adhesions
23679094 VAX1 rs10787760, rs6585429 and rs1871345 polymorphisms may be involved in nonsyndromic cleft lip with or without cleft palate in Brazilian patients, but there is no association with polymorphisms in FGF12, VCL, or CX43
23627409 Vinculin protein level in SW620 was much higher than that in SW480 cells.
23466368 Studies indicate that that vinculin not only bundles actin filaments but can also cap these filaments and promote actin polymerization.
23389630 Data indicate that lasp-2 interacts with the focal adhesion proteins vinculin and paxillin.
23159629 these data suggest that metavinculin enrichment in attachment sites of muscle cells leads to higher mechanical stability of adhesion complexes allowing for greater shear force resistance.
22940724 Western blotting demonstrated that vinculin was predominantly expressed in the pancreatic cancer tissues compared with non-cancerous tissues; findings indicate that vinculin may be a clinically useful biomarker of pancreatic cancer
22709580 These binding assays show that raver1 forms a ternary complex with metavinculin and vinculin mRNA.
22613835 The metavinculin promoted severing of actin filaments, most efficiently at substoichiometric concentrations.
22493458 binding studies suggest that vinculin must be in an activated state to bind to alpha-catenin and that this interaction is stabilized by the formation of a ternary alpha-catenin-vinculin-F-actin complex, which can be formed via the F-actin binding domain
22391038 Results implicate Vinculin-dependent VE-cadherin mechanosensing in endothelial processes such as leukocyte extravasation and angiogenesis.
22309306 Data show that SGK1 regulates cell migration via vinculin dephosphorylation, a mechanism that is controlled by membrane androgen receptor function.
22235119 alpha-catenin employs a novel mechanism to activate vinculin and may explain how vinculin is differentially recruited and/or activated in cell-cell and cell-matrix adhesions.
22017400 HIV-1 Nef co-localizes with vinvulin inside podosomes in human monocyte-derived macrophages
21841197 sca4 activates vinculin and interacts with the actin cytoskeleton; vinculin has roles in Rickettsia pathogenesis
21763488 Talin-1 and vinculin negatively affect tyrosine phosphorylation of paxillin, a novel positive regulator of HIV-1 infection, and impose an early block to infection by distinct retroviruses.
21525010 IpaA-directed mimicry of talin in activating vinculin occurs through three high affinity VBSs that are essential for Shigella pathogenesis.
21486952 When myosin II contractility was inhibited, the k(off) values for all three proteins changed rapidly, in a highly protein-specific manner: dissociation of vinculin from FAs was facilitated, whereas dissociation of paxillin and zyxin was attenuated.
21171262 VCL is expressed differently in benign prostatic hyperplasia and prostate cancer, which may serve as an indicator for the differential diagnosis of benign and malignant prostate diseases.
21076462 The data identify the kidney as a new organ site for ALK-associated carcinomas and VCL as a novel ALK fusion partner.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20502710 A helix replacement mechanism directs metavinculin's unique functions.
20474083 Observational study of genetic testing. (HuGE Navigator)
20086044 an interaction between beta-catenin and vinculin is crucial for stabilizing E-cadherin at the cell surface
19952892 This review discusses the general function of vinculin/metavinulin as well as talin 1 and talin 2, with emphasis on what is understood about their role in the cardiac myocyte and in whole heart.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19883375 Focal adhesion kinase expression reduced vinculin localization to focal adhesions by 35% independently of changes in integrin binding and localization of talin and paxillin.
19422016 Experiments on a nonphosphorylatable vinculin mutant construct at phosphorylation site tyr1065 confirmed the direct interplay between phosphorylation and exchange dynamics of adhesion proteins during adhesion site maturation.
19148538 the vinculin-talin-integrin system have a role in the transduction of mechanical force to the extracellular matrix
19052772 Vinculin has a similar staining pattern in liver as CRBP-1 but additionally stains SMCs, and (myo)fibroblasts.
18554503 The structural and biochemical properties of the last 21 residues of the vinculin tail domain were investigated.
18513529 Observational study of gene-disease association. (HuGE Navigator)
18353764 A subset of the tumor-specific splicing alterations (ACTN1, CALD1, and VCL) was found in all three organs and may represent general cancer-related splicing events.
18056416 The expression of vinculin constructs with unmasked binding sites in the head and tail regions induces dramatic focal adhesion growth, which is mediated by their direct interaction with talin.
18028034 alpha-synemin, but not beta-synemin, interacts with both vinculin and metavinculin
17932491 analysis of vinculin binding in its closed conformation by a helix addition mechanism
17709988 vinculin plays a role in growth regulation of neuroendocrine tumors and in expression of CLD4
17591693 Results decribe a mechanism in which signals from the T cell receptor produce WAVE2-ARP2/3-mediated de novo actin polymerization, leading to integrin clustering and high-affinity binding through the recruitment of vinculin and talin.
17088427 Invasin IpaA subverts vinculin's functions. Shigella flexneri utilizes a remarkable level of molecular mimicry of the talin-vinculin interaction to activate vinculin.
16949038 cardiac hypertrophy may be associated with different expression of the marker vinculin/metavinculin depending on the underlying pathophysiology
16826238 Vinculin is activated by virulence factor of Shigella flexneri.
16712796 a vinculin missense mutation confers susceptibility to hypertrophic cardiomyopathy
16608855 vinculin conformation, as modulated by the strength of HTI, directly regulates the formation and lifetime of talin-vinculin complexes in cells
16407302 vinculin binding to talin depends on stability of the helical bundles that make up the talin rod
16385451 Observational study of gene-disease association. (HuGE Navigator)
16236538 Same fundamental metavinculin mutation can yield either hypertrophic or dilated cardiomyopathic phenotype, underscoring a critical role for modifier genes and/or environmental stressors in cardiac remodeling.
15988023 A model is suggested where vinculin's Vh1 domain acts as a molecular switch that undergoes distinct structural changes provoked by talin and alpha-actinin binding in focal adhesions versus adherens junctions, respectively.
15883197 Beyond providing direct evidence that vinculin is activated at focal adhesions, this study shows that the specific functional conformation correlates with regional cellular dynamics.
15728584 two head-tail interfaces cooperate to suppress activation of vinculin by talin
15547664 immunohistochemistry of vinculin in alpha- and gamma-sarcoglycanopathy
15229287 vinculin is tyrosine phosphorylated in platelets spread on fibrinogen, and the phosphorylation is Src kinases dependent
15070891 Findings support a model in which talin binds to and activates multiple vinculin molecules to provoke rapid reorganization of the actin cytoskeleton.
14702644 crystal structures of human vinculin in its inactive and talin-activated states
14597672 HIV-1 Nef co-localizes with vinvulin inside podosomes in human monocyte-derived macrophages
11741957 Here, we report on a transient interaction between the lipid-dependent protein kinase Calpha and vinculin, an early component of these sites, during spreading of HeLa cells on collagen

AA Sequence

MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQIL      1 - 70
KRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKG     71 - 140
ILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMK    141 - 210
IFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQA    211 - 280
KGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAM    281 - 350
QKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE    351 - 420
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAA    421 - 490
VHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAA    491 - 560
RGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERA    561 - 630
ANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKN    631 - 700
QWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKRE    701 - 770
VENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP    771 - 840
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEAR    841 - 910
KWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKW    911 - 980
SSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLL    981 - 1050
QVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDA   1051 - 1120
GFTLRWVRKTPWYQ                                                           1121 - 1134
//

Text Mined References (153)

PMID Year Title
26728462 2016 Mechanisms and Functions of Vinculin Interactions with Phospholipids at Cell Adhesion Sites.
26691986 2016 Mutations in CTNNA1 cause butterfly-shaped pigment dystrophy and perturbed retinal pigment epithelium integrity.
26650627 2016 Malignant pheochromocytomas/paragangliomas harbor mutations in transport and cell adhesion genes.
26493222 2016 The Structural Basis of Actin Organization by Vinculin and Metavinculin.
26487440 2015 Sex-specific association of rs4746172 of VCL gene with hypertension in two Han populations from Southern China.
26109125 2015 A plastic relationship between vinculin-mediated tension and adhesion complex area defines adhesion size and lifetime.
26053221 2015 Molecular mechanism of vinculin activation and nanoscale spatial organization in focal adhesions.
25997717 2015 Integrin ?4 and vinculin contained in exosomes are potential markers for progression of prostate cancer associated with taxane-resistance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25942574 2015 Crossreactivity to vinculin and microbes provides a molecular basis for HLA-based protection against rheumatoid arthritis.
25496021 2014 Loss of vinculin and membrane-bound ?-catenin promotes metastasis and predicts poor prognosis in colorectal cancer.
25488920 2014 Lipid binding promotes oligomerization and focal adhesion activity of vinculin.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25449281 2014 Vinculin negatively regulates transcription of MT1-MMP through MEK/ERK pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25298412 2014 Identification of vinculin as a potential plasma marker for age-related macular degeneration.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
24878663 2014 Structural investigation of the interaction between the tandem SH3 domains of c-Cbl-associated protein and vinculin.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24751539 2014 Vinculin phosphorylation differentially regulates mechanotransduction at cell-cell and cell-matrix adhesions.
24698962 2014 VCL-ALK renal cell carcinoma in children with sickle-cell trait: the eighth sickle-cell nephropathy?
24466349 2014 Vinculin and Rab5 complex is required [correction of requited]for uptake of Staphylococcus aureus and interleukin-6 expression.
24452377 2014 Force-dependent vinculin binding to talin in live cells: a crucial step in anchoring the actin cytoskeleton to focal adhesions.
24452080 2014 Actomyosin-dependent formation of the mechanosensitive talin-vinculin complex reinforces actin anchoring.
24446374 2014 Vinculin regulates assembly of talin: ?3 integrin complexes.
24369271 2014 Plasma proteome profiling of atherosclerotic disease manifestations reveals elevated levels of the cytoskeletal protein vinculin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24219282 2013 p38 mitogen-activated protein kinase interacts with vinculin at focal adhesions during fatty acid-stimulated cell adhesion.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23687380 2013 Vinculin tension distributions of individual stress fibers within cell-matrix adhesions.
23679094 2013 Polymorphisms in FGF12, VCL, CX43 and VAX1 in Brazilian patients with nonsyndromic cleft lip with or without cleft palate.
23627409 2013 Association of Nox1 and vinculin with colon cancer progression.
23466368 2013 Vinculin and metavinculin: oligomerization and interactions with F-actin.
23389630 2013 Investigating lasp-2 in cell adhesion: new binding partners and roles in motility.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159629 2013 Metavinculin: New insights into functional properties of a muscle adhesion protein.
22940724 2012 Proteomic differential display identifies upregulated vinculin as a possible biomarker of pancreatic cancer.
22709580 2012 The metavinculin tail domain directs constitutive interactions with raver1 and vinculin RNA.
22613835 2012 The C-terminal tail domain of metavinculin, vinculin's splice variant, severs actin filaments.
22493458 2012 The cytoskeletal protein ?-catenin unfurls upon binding to vinculin.
22427331 2012 KIAA1797/FOCAD encodes a novel focal adhesion protein with tumour suppressor function in gliomas.
22391038 2012 Vinculin associates with endothelial VE-cadherin junctions to control force-dependent remodeling.
22309306 2012 Serum- and glucocorticoid-dependent kinase-1-induced cell migration is dependent on vinculin and regulated by the membrane androgen receptor.
22235119 2012 ?-Catenin uses a novel mechanism to activate vinculin.
21841197 2011 The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin.
21763488 2011 Focal adhesion proteins talin-1 and vinculin negatively affect paxillin phosphorylation and limit retroviral infection.
21525010 2011 Novel vinculin binding site of the IpaA invasin of Shigella.
21486952 2011 Actomyosin-generated tension controls the molecular kinetics of focal adhesions.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21171262 2010 [Vinculin and the androgen receptor in prostate cancer: expressions and correlations].
21076462 2011 Renal cell carcinoma with novel VCL-ALK fusion: new representative of ALK-associated tumor spectrum.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20502710 2010 A helix replacement mechanism directs metavinculin functions.
20484056 2010 Vinculin is a dually regulated actin filament barbed end-capping and side-binding protein.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20086044 2010 Vinculin regulates cell-surface E-cadherin expression by binding to beta-catenin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19952892 2009 Vinculin and talin: focus on the myocardium.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19883375 2010 Focal adhesion kinase-dependent regulation of adhesive forces involves vinculin recruitment to focal adhesions.
19725078 2009 Proteomic analysis of increased Parkin expression and its interactants provides evidence for a role in modulation of mitochondrial function.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19422016 2009 Becoming stable and strong: the interplay between vinculin exchange dynamics and adhesion strength during adhesion site maturation.
19148538 2009 Dystrophin-glycoprotein complex and vinculin-talin-integrin system in human adult cardiac muscle.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19052772 2009 Vinculin and cellular retinol-binding protein-1 are markers for quiescent and activated hepatic stellate cells in formalin-fixed paraffin embedded human liver.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18554503 2008 Direct evidence of vinculin tail-lipid membrane interaction in beta-sheet conformation.
18513529 2008 Relationship between sex, shape, and substrate in hypertrophic cardiomyopathy.
18353764 2008 Alternative splicing in colon, bladder, and prostate cancer identified by exon array analysis.
18341635 2008 beta-Dystroglycan modulates the interplay between actin and microtubules in human-adhered platelets.
18056416 2007 Vinculin controls focal adhesion formation by direct interactions with talin and actin.
18028034 2008 Human alpha-synemin interacts directly with vinculin and metavinculin.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17932491 2007 Vinculin binding in its closed conformation by a helix addition mechanism.
17709988 2007 Expression and function of vinculin in neuroendocrine tumors.
17591693 2007 WAVE2 regulates high-affinity integrin binding by recruiting vinculin and talin to the immunological synapse.
17289036 2007 Capping of actin filaments by vinculin activated by the Shigella IpaA carboxyl-terminal domain.
17088427 2006 Shigella applies molecular mimicry to subvert vinculin and invade host cells.
17082770 2006 CAP interacts with cytoskeletal proteins and regulates adhesion-mediated ERK activation and motility.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16949038 2006 Obstructive hypertrophic cardiomyopathy is associated with reduced expression of vinculin in the intercalated disc.
16826238 2006 Structural mimicry for vinculin activation by IpaA, a virulence factor of Shigella flexneri.
16803572 2006 Role of dystrophins and utrophins in platelet adhesion process.
16712796 2006 A missense mutation in a ubiquitously expressed protein, vinculin, confers susceptibility to hypertrophic cardiomyopathy.
16608855 2006 A conformational switch in vinculin drives formation and dynamics of a talin-vinculin complex at focal adhesions.
16407302 2006 The activity of the vinculin binding sites in talin is influenced by the stability of the helical bundles that make up the talin rod.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16236538 2006 Identification of a metavinculin missense mutation, R975W, associated with both hypertrophic and dilated cardiomyopathy.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
15988023 2005 Structural dynamics of alpha-actinin-vinculin interactions.
15883197 2005 Spatial distribution and functional significance of activated vinculin in living cells.
15728584 2005 Two distinct head-tail interfaces cooperate to suppress activation of vinculin by talin.
15547664 2004 Evaluation of sarcoglycans, vinculin-talin-integrin system and filamin2 in alpha- and gamma-sarcoglycanopathy: an immunohistochemical study.
15501673 2004 Vinculin--a dynamic regulator of cell adhesion.
15494027 2004 Cytoskeletal proteins talin and vinculin in integrin-mediated adhesion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15229287 2004 The phosphorylation of vinculin on tyrosine residues 100 and 1065, mediated by SRC kinases, affects cell spreading.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15163412 2004 RNA and RNA binding proteins participate in early stages of cell spreading through spreading initiation centers.
15070891 2004 Structural basis for amplifying vinculin activation by talin.
14702644 2004 Vinculin activation by talin through helical bundle conversion.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14627618 2003 Smooth muscle contraction and relaxation.
12719976 2003 Vinculin: a novel marker for quiescent and activated hepatic stellate cells in human and rat livers.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473693 2002 Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion.
11815424 2002 Metavinculin mutations alter actin interaction in dilated cardiomyopathy.
11741957 2002 A lipid-regulated docking site on vinculin for protein kinase C.
11724819 2001 Raver1, a dual compartment protein, is a ligand for PTB/hnRNPI and microfilament attachment proteins.
11693560 2001 Distribution of cytoskeletal proteins, integrins, leukocyte adhesion molecules and extracellular matrix proteins in plastic-embedded human and rat kidneys.
11577104 2001 Phosphatidylinositol 3,4,5-trisphosphate directs association of Src homology 2-containing signaling proteins with gelsolin.
11541859 1995 Effects of hypergravity on the cell shape and on the organization of cytoskeleton and extracelluar matrix molecules of in vitro human dermal fibroblasts.
11409571 2001 Expression profiles of cell-cell and cell-matrix junction proteins in developing human epidermis.
11358843 2001 von Hippel-Lindau protein promotes the assembly of actin and vinculin and inhibits cell motility.
11113628 2000 Modification of the composition of polycystin-1 multiprotein complexes by calcium and tyrosine phosphorylation.
10908164 2000 Immunofluorescence distribution of actin-associated proteins in human seminiferous tubules of adolescent testes, normal and pathologic.
10882740 2000 Phosphorylation of the vasodilator-stimulated phosphoprotein regulates its interaction with actin.
10545505 1999 Degraded collagen fragments promote rapid disassembly of smooth muscle focal adhesions that correlates with cleavage of pp125(FAK), paxillin, and talin.
10521485 1999 nArgBP2, a novel neural member of ponsin/ArgBP2/vinexin family that interacts with synapse-associated protein 90/postsynaptic density-95-associated protein (SAPAP).
10320934 1999 Integrin-mediated cell adhesion: the cytoskeletal connection.
10320340 1999 Molecular interactions of N-RAP, a nebulin-related protein of striated muscle myotendon junctions and intercalated disks.
10224093 1999 A neurally enriched coronin-like protein, ClipinC, is a novel candidate for an actin cytoskeleton-cortical membrane-linking protein.
10085297 1999 Ponsin/SH3P12: an l-afadin- and vinculin-binding protein localized at cell-cell and cell-matrix adherens junctions.
9885244 1999 Vinexin: a novel vinculin-binding protein with multiple SH3 domains enhances actin cytoskeletal organization.
9700171 1998 alpha-Catenin-vinculin interaction functions to organize the apical junctional complex in epithelial cells.
9415431 1997 Spatial and temporal expression of the beta1D integrin during mouse development.
9054445 1997 Monocyte cells and cancer cells express novel paxillin isoforms with different binding properties to focal adhesion proteins.
8994410 1997 Dilated cardiomyopathy associated with deficiency of the cytoskeletal protein metavinculin.
8612698 1996 Modulation of expression and assembly of vinculin during in vitro fibrillar collagen-induced angiogenesis and its reversal.
8610074 1995 Developmental regulation of focal contact protein expression in human melanocytes.
8609175 1996 Leukocyte adhesion to vascular endothelium induces E-selectin linkage to the actin cytoskeleton.
8440716 1993 Organization of the human gene encoding the cytoskeletal protein vinculin and the sequence of the vinculin promoter.
8276759 1993 Interaction of vinculin with the clathrin heavy chain.
7994488 The intracellular distribution of vinculin and alpha 2 integrin in epithelial cells and chondrocytes.
7816144 1995 F-actin binding site masked by the intramolecular association of vinculin head and tail domains.
7682697 1993 Pattern formation and handedness in the cytoskeleton of human platelets.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7534286 1995 Molecular cloning of human paxillin, a focal adhesion protein phosphorylated by P210BCR/ABL.
7525621 1994 Primary sequence of paxillin contains putative SH2 and SH3 domain binding motifs and multiple LIM domains: identification of a vinculin and pp125Fak-binding region.
6457647 1981 Characterization of the proteins of isolated human platelet alpha-granules. Evidence for a separate alpha-granule-pool of the glycoproteins IIb and IIIa.
2503380 1989 Detection of metavinculin in human platelets using a modified talin overlay assay.
2116004 1990 Complete sequence of human vinculin and assignment of the gene to chromosome 10.
1505973 1992 Complementary physical and genetic techniques map the vinculin (VCL) gene on chromosome 10q.
1339348 1992 An additional exon in the human vinculin gene specifically encodes meta-vinculin-specific difference peptide. Cross-species comparison reveals variable and conserved motifs in the meta-vinculin insert.