Property Summary

NCBI Gene PubMed Count 151
PubMed Score 2107.07
PubTator Score 1025.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.200 1.3e-02
atypical teratoid / rhabdoid tumor 1.900 5.4e-06
axial spondyloarthropathy 1.100 3.7e-03
colon cancer -3.700 2.8e-05
diabetes mellitus -1.200 5.4e-03
glioblastoma 1.400 3.6e-02
group 4 medulloblastoma -1.500 3.5e-05
lung cancer -1.100 6.9e-04
lung carcinoma -1.600 2.3e-19
ovarian cancer -1.200 9.6e-06
pancreatic cancer 1.100 6.0e-03
pancreatic ductal adenocarcinoma liver m... 1.051 3.9e-02
posterior fossa group A ependymoma 1.100 9.9e-07
subependymal giant cell astrocytoma 1.337 2.0e-02
tuberculosis 1.600 1.4e-06

PDB (30)

Gene RIF (88)

AA Sequence

MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQIL      1 - 70
KRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKG     71 - 140
ILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMK    141 - 210
IFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQA    211 - 280
KGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAM    281 - 350
QKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE    351 - 420
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAA    421 - 490
VHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAA    491 - 560
RGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERA    561 - 630
ANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKN    631 - 700
QWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKRE    701 - 770
VENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP    771 - 840
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEAR    841 - 910
KWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKW    911 - 980
SSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLL    981 - 1050
QVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDA   1051 - 1120
GFTLRWVRKTPWYQ                                                           1121 - 1134
//

Text Mined References (162)

PMID Year Title