Property Summary

NCBI Gene PubMed Count 62
PubMed Score 58.33
PubTator Score 45.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Disease Target Count Z-score Confidence
Keshan disease 14 3.017 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.511 1.4e-05
primitive neuroectodermal tumor 1.100 7.6e-03
intraductal papillary-mucinous adenoma (... -1.500 2.3e-03
colon cancer 1.100 1.0e-02
breast carcinoma 1.200 8.4e-04
gastric carcinoma 1.400 1.0e-02
ovarian cancer 1.600 4.2e-05
pituitary cancer -1.300 1.2e-04

Gene RIF (49)

PMID Text
26919541 The crystal structure of the complex between a phosphorylated PPxY motif of TXNIP and the SH2 domain of Vav2 reveals a conserved recognition mechanism.
26224100 Our data provide the first evidence to implicate VAV2 in glucose-induced Rac1 activation, actin remodelling and glucose-stimulated insulin secretion in pancreatic beta cells.
24858039 Authors propose a model whereby vimentin promotes FAK stabilization through VAV2-mediated Rac1 activation. This model may explain why vimentin expressing metastatic lung cancer cells are more motile and invasive.
24835487 VAV2 is required for Met signaling in the perinuclear endosome.
23986795 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
23847689 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
23724134 the guanine nucleotide exchange factor (GEF) Vav2 is identified as a candidate partner for KCC3.
23615439 Data suggest a coordination between paxillin kinase linker (PKL)/Vav2 signaling and PKL/beta-PIX signaling during cell migration.
23402756 Two variants of VAV2 and VAV3, rs2156323 and rs2801219, respectively, were identified in Japanese patients with primary open angle glaucoma, normal tension glaucoma, and developmental glaucoma.
23033540 Data indicate that Vav2 and Vav3 controlled a vast transcriptional program in breast cancer cells through mechanisms that were shared between the two proteins, isoform-specific or synergistic.
23033535 Studies indicate relevance of P-Rex1 and P-Rex2a, in breast tumorigenesis, and suggest that the exchange factors Vav2 and Vav3 play synergistic roles in breast cancer by sustaining tumor growth, neoangiogenesis, and metastasis.
22946057 Upregulation of Rac1 activity by Wnt3a temporally correlated with enhanced p120-catenin binding to Rac1 and Vav2.
22750419 The structural basis for the interaction between Arap3 and Vav2, hydrophobic pockets and binding specificity.
22554804 VAV2 specifically interacts with activated Galpha(q) but not with Galpha(s) subunits, competing with parathyroid hormone receptor for coupling to Galpha(q).
21738584 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
20808760 Type IV pili producing Neisseria gonorrhoeae triggers a phosphotyrosine-dependent Cav1-Vav2-RhoA signaling cascade that elicits cytoskeletal rearrangements and effectively impedes bacterial uptake into host cells.
20598377 VAV2 has been identified as a candidate gene in a genome-wide association study of German multiple sclerosis patients.
20598377 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20463313 present data indicate a lack of involvement of variations in NTF4, VAV2, and VAV3 with glaucoma pathogenesis in an Indian population.
20463313 Observational study of gene-disease association. (HuGE Navigator)
20298788 Together, we suggest that balanced Vav2 activity is necessary for optimal neurite outgrowth and promotes branching by targeting GEF activity to branch points.
20140222 Data strongly suggest that VAV2 and VAV3 genes are susceptibility loci in Japanese primary open-angle glaucoma.
20140013 Vav2 can regulate growth factors receptor signalling by slowing receptor internalization and degradation through its interaction with endosome-associated proteins.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19826000 RhoA knockdown intensified the Vav2-induced disruption of acini, leading to more aggressive cell outgrowth and branching morphogenesis.
19451809 Interaction of L2 with Vav2 was mediated by the N-terminus of L2 and independent of the N-terminus of Vav2.
19149577 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
18829495 IMC-C225 cross-links integrins with EGFR, leading to Vav2-dependent activation of RhoA
18473783 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
18094167 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
17707624 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
17686471 Vav2 acts downstream of VEGF to activate Rac1.
17234718 The EGFR/Vav2/Rac1 axis is a crucial pathway for the acquisition of motile and invasive properties of most head and neck squamous cell carcinoma cells.
16454711 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
16356860 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
16091223 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
15850391 Vav2-mediated nucleotide exchange of Rho GTPases follows the Theorell-Chance catalytic mechanism in which Vav2.Rho GTPase complex is the major species during the exchange process and Vav2.GDP-Mg2+.Rho GTPase ternary complex is present only transiently.
15479739 Rap1 promotes cell spreading by localizing a subset of Rac GEFs to sites of active lamellipodia extension
15345594 3BP2 may regulate b cell receptor-mediated gene activation through Vav proteins.
14597672 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
12884293 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
12810717 Vav2 and Tiam1 may act as downstream effectors of Src, thereby regulating Rac1-dependent pathways that participate in Src-induced cell transformation
12734410 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
11909943 Critical but distinct roles for the pleckstrin homology and cysteine-rich domains as positive modulators of Vav2 signaling and transformation.
11525746 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
11463741 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
11448999 Vav2 is a GDP/GTP exchange factor (GEF) for Rac in vivo.
10394361 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade
9269777 The C-terminal SH3 domain of Vav binds to the PXXP motif in HIV-1 Nef and this interaction activates Vav and its downstream effectors, leading to morphological changes, cytoskeletal rearrangements, and the activation of the JNK/SAPK cascade

AA Sequence

MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFL      1 - 70
CLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQNKGIRPFPSEETTENDDD     71 - 140
VYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETE    141 - 210
AKYYRTLEDIEKNYMSPLRLVLSPADMAAVFINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERL    211 - 280
LIYGEYCSHMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHS    281 - 350
AERPERQQLKEALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH    351 - 420
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFYLIHLQGKQGF    421 - 490
QFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYMCTKCGVG    491 - 560
AHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGNPAPPGKPVLTFQTGDVLELLRGDPESPWWE    561 - 630
GRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRER    631 - 700
PAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSR    701 - 770
ERSASRASSRSPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG    771 - 840
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ                                    841 - 878
//

Text Mined References (74)

PMID Year Title
26919541 2016 Structural basis for a novel interaction between TXNIP and Vav2.
26224100 2015 VAV2, a guanine nucleotide exchange factor for Rac1, regulates glucose-stimulated insulin secretion in pancreatic beta cells.
24858039 2015 Vimentin regulates lung cancer cell adhesion through a VAV2-Rac1 pathway to control focal adhesion kinase activity.
24835487 2014 Receptor tyrosine kinase c-Met controls the cytoskeleton from different endosomes via different pathways.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23724134 2013 Potassium-chloride cotransporter 3 interacts with Vav2 to synchronize the cell volume decrease response with cell protrusion dynamics.
23615439 2013 Paxillin kinase linker (PKL) regulates Vav2 signaling during cell spreading and migration.
23402756 2013 Molecular genetic analysis of primary open-angle glaucoma, normal tension glaucoma, and developmental glaucoma for the VAV2 and VAV3 gene variants in Japanese subjects.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033540 2012 The rho exchange factors vav2 and vav3 control a lung metastasis-specific transcriptional program in breast cancer cells.
23033535 2012 Rho GEFs and cancer: linking gene expression and metastatic dissemination.
22946057 2012 Upon Wnt stimulation, Rac1 activation requires Rac1 and Vav2 binding to p120-catenin.
22750419 2012 Identification and structural basis for a novel interaction between Vav2 and Arap3.
22554804 2012 The guanine nucleotide exchange factor Vav2 is a negative regulator of parathyroid hormone receptor/Gq signaling.
22467863 2012 Radixin regulates cell migration and cell-cell adhesion through Rac1.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21269460 2011 Initial characterization of the human central proteome.
20808760 2010 Tyrosine-phosphorylated caveolin-1 blocks bacterial uptake by inducing Vav2-RhoA-mediated cytoskeletal rearrangements.
20598684 2010 Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.
20598377 2010 Evidence for VAV2 and ZNF433 as susceptibility genes for multiple sclerosis.
20463313 2010 Variations in NTF4, VAV2, and VAV3 genes are not involved with primary open-angle and primary angle-closure glaucomas in an indian population.
20298788 2010 Balanced Vav2 GEF activity regulates neurite outgrowth and branching in vitro and in vivo.
20140222 2010 VAV2 and VAV3 as candidate disease genes for spontaneous glaucoma in mice and humans.
20140013 2010 VAV2 regulates epidermal growth factor receptor endocytosis and degradation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19826000 2010 Distinct roles for Rho versus Rac/Cdc42 GTPases downstream of Vav2 in regulating mammary epithelial acinar architecture.
19451809 Guanine exchange factor Vav2: a novel potential target for the development of drugs effective in the prevention of papillomavirus infection and disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18829495 2008 Therapeutic IMC-C225 antibody inhibits breast cancer cell invasiveness via Vav2-dependent activation of RhoA GTPase.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17686471 2007 VEGF-induced Rac1 activation in endothelial cells is regulated by the guanine nucleotide exchange factor Vav2.
17234718 2007 Persistent activation of Rac1 in squamous carcinomas of the head and neck: evidence for an EGFR/Vav2 signaling axis involved in cell invasion.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16381901 2006 The LIFEdb database in 2006.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
15850391 2005 Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.
15618286 2005 Novel association of Vav2 and Nek3 modulates signaling through the human prolactin receptor.
15561106 2005 The proto-oncogene Fgr regulates cell migration and this requires its plasma membrane localization.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479739 2004 Rap1 promotes cell spreading by localizing Rac guanine nucleotide exchange factors.
15345594 2005 The adaptor protein 3BP2 associates with VAV guanine nucleotide exchange factors to regulate NFAT activation by the B-cell antigen receptor.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810717 2003 Rac1 function is required for Src-induced transformation. Evidence of a role for Tiam1 and Vav2 in Rac activation by Src.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454019 2003 Mechanism of epidermal growth factor regulation of Vav2, a guanine nucleotide exchange factor for Rac.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11909943 2002 Critical but distinct roles for the pleckstrin homology and cysteine-rich domains as positive modulators of Vav2 signaling and transformation.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11606575 2001 Hyaluronan promotes CD44v3-Vav2 interaction with Grb2-p185(HER2) and induces Rac1 and Ras signaling during ovarian tumor cell migration and growth.
11516622 2001 Membrane-targeting is critical for the phosphorylation of Vav2 by activated EGF receptor.
11448999 2001 Vav2 is required for cell spreading.
11390470 2001 Regulation of NK cell-mediated cytotoxicity by the adaptor protein 3BP2.
11313921 2001 c-Cbl facilitates fibronectin matrix production by v-Abl-transformed NIH3T3 cells via activation of small GTPases.
11262396 2001 Vav2 activates c-fos serum response element and CD69 expression but negatively regulates nuclear factor of activated T cells and interleukin-2 gene activation in T lymphocyte.
11080163 2000 Vav-2 controls NFAT-dependent transcription in B- but not T-lymphocytes.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10982832 2000 Vav2 activates Rac1, Cdc42, and RhoA downstream from growth factor receptors but not beta1 integrins.
10938113 2000 Vav family proteins couple to diverse cell surface receptors.
10618391 2000 Analysis of receptor signaling pathways by mass spectrometry: identification of vav-2 as a substrate of the epidermal and platelet-derived growth factor receptors.
10022833 1999 Socs1 binds to multiple signalling proteins and suppresses steel factor-dependent proliferation.
9438848 1998 Role of substrates and products of PI 3-kinase in regulating activation of Rac-related guanosine triphosphatases by Vav.
9115846 1996 Structure and function of vav.
8990121 1997 Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.
8986718 1996 Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.
7762982 1995 Identification of VAV2 on 9q34 and its exclusion as the tuberous sclerosis gene TSC1.