Property Summary

NCBI Gene PubMed Count 177
PubMed Score 465.90
PubTator Score 296.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.851 1.9
Disease Target Count Z-score Confidence
Cherubism 14 4.4 2.2

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.700 2.5e-03
osteosarcoma -3.905 7.0e-08
interstitial cystitis 1.400 2.8e-03
subependymal giant cell astrocytoma 1.266 2.0e-02
spina bifida 1.036 4.2e-02

Gene RIF (107)

PMID Text
26043137 revealed a new function for Vav1 in the negative feedback regulation of the phosphorylation of immunoreceptor tyrosine-based activation motifs within the zeta chains, CD3 delta, epsilon, gamma chains, as well as activation sites on the critical T cell tyrosine kinases
25539813 our data provide evidence that Vav1 is the linker molecule that couples CD28 to PIP5Kalpha activation and strongly fit with a potential model in which CD28 regulates PIP2 synthesis and turnover in T lymphocytes.
25531316 These findings establish VAV1 as a critical epigenetically regulated oncogene with a key role in MBSHH maintenance, and highlight its potential as a validated therapeutic target and prognostic biomarker for the improved therapy of medulloblastoma.
25426554 Data indicate that only a single mutation in the proto-oncogene Vav1 enhances tumorigenicity.
25313137 results presented herein suggest a potential cross-talk between cancer cells and the microenvironment controlled by CSF1/Vav1 signaling pathways.
24905577 The present study implies that estrogen-estrogen receptor modulates the transcription and expression of Vav1, which may contribute to the proliferation of cancerous cells.
24880064 The role of Vav1 in T leukemia survival by selectively triggering Rac2-Akt axis and elevating the expression of anti-apoptotic Bcl-2.
24332539 suggest that Vav1 promotes the matrix-degrading processes underlying tumor cell migration and further, under conditions of ectopic Vav1 expression, that Vav1 is a central regulator and major driver of invasive matrix remodeling by pancreatic tumor cells
23986795 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
23856093 VAV1 overexpression in both SKOV3 and human ovarian surface epithelial cells demonstrated that its upregulation of an E-cadherin transcriptional repressor, Snail and Slug, was not confined to ovarian cancer cells
23847689 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
23559827 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
23537630 study provides evidence the large GTPase Dyn2 regulates the small GTPase Rac1 to potentiate invasive migration of pancreatic tumor cells; Dyn2 plays an essential role in regulating Rac1-mediated pancreatic tumor cell migration through modulation of the Rac1 activator Vav1 via a direct interaction
23420881 TCR-driven transendothelial migration of human effector memory CD4 T cells involves Vav, Rac, and myosin IIA.
23342133 The results highlight for the first time the potential role of Vav1 as an oncogenic stress activator in cancer and the p53 dependence of its pro-apoptotic effect in breast cells.
23325923 c-Abl tyrosine kinase plays a critical role in beta2 integrin-dependent neutrophil migration by regulating Vav1 activity.
23271736 This study highlights the importance of the N-terminal 20 aa of Vav1 for CaM binding, and provides new insights into the distinguished and irreplaceable role of Vav1 in T cell activation and signal transduction.
23058036 Suggest Vav1 as an autosomal dominant disease gene associated with common variable immunodeficiency with defective T-cell function.
22864683 immunohistochemical experiments revealed that VAV1 is not expressed in glioma cells. Instead, VAV1 is found in non-tumoural astrocyte-like cells that are located either peritumouraly or perivascularly
22844345 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
22534133 both T cell activation and the association between SLP-76 and Nck. After T cell receptor stimulation, SLP-76 was phosphorylated, which enabled the binding of Nck.
22395814 these results establish LIME as a transmembrane adaptor protein linking TCR stimulation to IS formation and integrin activation through activation of Vav(Vav guanine nucleotide exchange factor)
22351766 Substituting Vav1-specific residues into the C1b domain of PKCdelta, we identified five crucial residues (Glu(9), Glu(10), Thr(11), Thr(24), and Tyr(26)) along the rim of the binding cleft that weaken binding potency in a cumulative fashion.
22323535 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
22253833 These data identify two regulatory mechanisms for vav1 expression: binding of c-Myb and CpG methylation of 5' regulatory sequences.
21994733 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
21948080 Data reveal a key role for Vav1-dependent T cell antigen receptor signaling in Foxp3 natural T(reg) cell development.
21856460 results provide the first evidence that, at least in maturation of tumoral myeloid precursors, Vav1 is part of interconnected networks of functionally related proteins ended to regulate different aspects of gene expression
21756249 EHD2 associates in the plasma membrane with Vav1, a Nek3-regulated GEF (guanine-nucleotide-exchange factor) for Rho GTPases.
21738584 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
21647562 In tumoral promyelocytes, Vav1 is a component of lineage-specific transduction machineries that can be recruited by various differentiating agents.
21632469 The integration of activating and inhibitory receptor signaling by regulated phosphorylation of Vav1 in NK cells.
21386095 Vav1-mediated scaffolding interactions stabilize SLP-76 microclusters and contribute to antigen-dependent T cell responses.
21344162 CDC25A, VAV1, TP73, BRCA1 and ZAP70 may be novel markers for predicting the effectiveness of radiotherapy in CRC patients.
21206905 LFA-1-induced stabilization of ARE-containing mRNAs in T cells is dependent on HuR, and occurs through the Vav-1, Rac1/2, MKK3 and p38MAPK signaling cascade
21151158 VAV1 protects Jurkat cells from apoptosis by promoting Bcl-2 transcription through its guanine nucleotide exchange factor activity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20562827 Results define the composition, stoichiometry and specificity of interactions in the SLP-76, Nck and VAV1 complex, which is crucial for regulation of the actin machinery after T-cell activation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20189481 gene knockdown blocks NK cell cytotoxicity triggered by NKG2D and 2B4 coengagement
20155735 Vav-1 expression may be associated with activated B-cell DLBCL origin and higher proliferative activity, and indicate Vav-1 as a potential marker to identify tumours likely to respond to CD40-targeted therapies.
20141838 Study reports the structure and biophysical and cellular analyses of the five-domain autoinhibitory element of Vav1; the catalytic Dbl homology (DH) domain of Vav1 is controlled by two energetically coupled processes.
20028078 overexpression of a mutated form of Vav1, in which Y745 was replaced with a phenylalanine, significantly reduced the ATRA-induced CD11b expression and essentially abrogated the differentiation-related acquisition of the migratory capability
20011522 These data reveal unexpected negative roles for Vav1 and RasGRF2 in different stages of T-cell lymphoma progression.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19880579 signaling is required for T-cell activation partly by inhibiting activation-induced proteolysis of Vav1.
19747912 ATRA-induced increase of Vav1 expression and phosphorylation may be involved in recruiting PU.1 to the CD11b promoter and in regulating CD11b expression during the late stages of neutrophil differentiation of APL-derived promyelocytes.
19597340 IDO suppressed Vav1 mRNA and protein production in T cells. IDO inhibited TCR-activation-induced Vav1 phosphorylation.
19207108 Pyk2 is a critical signalling molecule downstream of beta3 integrin tyrosine phosphorylation and mediates Vav1 recruitment to accomplish actin reorganization necessary for adhesion
19149577 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
19018007 while Vav-1 and LAT preferentially bound to Syk, phospholipase C-gamma1 bound to both Syk and ZAP-70
18974050 the Vav pathway is ramified in B-lymphocytes in additional diacylglycerol-dependent signaling branches such as those involving protein kinase C, protein kinase D, and phospholipase D
18589439 Structural basis of guanine nucleotide exchange mediated by the T-cell essential Vav1 is reported.
18473783 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
18295596 Our findings define a pathway involving CD28 binding to Grb-2 and its co-operativity with Vav1 in the regulation of T-cell co-stimulation.
18160398 a VAV1-Rac1-PAK1 signaling axis in mononuclear phagocytes regulating superoxide production in a stimulus-dependent manner.
18160397 CD147, via the selective inhibition of specific downstream elements of the Vav1/Rac1 route, contributes to the negative regulation of T-cell responses.
18094167 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
17716865 The data provide the first evidence of a role of glycerophosphoinositols as modulators of T-cell signaling and establish a mechanistic basis for the effects of this phosphoinositide derivative on F-actin dynamics.
17707624 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
17590270 This review addresses the physiological function of wild-type Vav1, its mode of activation as an oncogene, and its emerging role as a transforming protein in human cancer.
17550897 the calponin homology domain of Vav1 associates with calmodulin and is prerequisite to T cell antigen receptor-induced calcium release in Jurkat T lymphocytes
17275330 Remedial strategies in structural proteomics were used for the expression, purification, and crystallization of the VAV1/RAC1 complex.
17237383 phosphorylation of the adaptor molecule SLP-76 is essential for recruitment of the exchange factor Vav leading to Ca(2+) flux and IL-2 production
17060455 chemoattractant-stimulated superoxide production can be amplified by a positive feedback loop in which p67(phox) targets Vav1-mediated Rac activation
17050525 Vav1 Tyr(174) is essential for maintaining the inhibitory constraint of the DH domain in both developing and mature T cells, constitutively activated Vav GEF disrupts TCR-signaling microclusters and leads to defective T cell development and proliferation
17015707 comparison of DOCK2 and Vav1 involvement in CXCL12-promoted Rac activation and alpha4beta1-dependent human T cell adhesion indicated a more prominent role of Vav1 than DOCK2
16728400 Vav activity is required for fAbeta-stimulated intracellular signaling events upstream of reactive oxygen species production and phagosome formation
16454711 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
16356860 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
16289966 CD21 activation triggered Cbl tyrosine phosphorylation, which interacts with SH2 domains of p85 subunit, SH2 domains of Crk-L and with tyrosine phosphorylated Syk kinase. CD21 activation triggers dissociation of Cbl-Vav complex.
16091223 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
15878332 Vav plays crucial functions in the maturation process of myeloid cells.
15872091 activation of Vav1-Rac signaling pathway by CXCL12 represents an important inside-out event controlling efficient up-regulation of alpha4beta1-dependent T lymphocyte adhesion
15850391 Isolated Vav1 cysteine-rich domain (CRD) directly associates with Rac1, and residues K116 and S83 in the proximity of the P-loop and the guanine base either are part of this binding interface or undergo a conformational change following CRD binding.
15817684 essential role of Vav in T cells, and Vav insufficiency in common variable immunodeficiency characterized by T-cell defects
15699036 there is a phosphorylation-dependent association between beta(3) integrin and Vav1 which is essential for cell progression to a Rho-dominant phenotype during cell adhesion
15652748 Data show that VAV1 is ectopically expressed in primary pancreatic adenocarcinomas due to demethylation of the gene promoter; identified as a growth-stimulatory protein in this disease
15618472 pivotal role for Vav in the transmission of the migratory signal through the chemokine receptor CXCR4
15345594 3BP2 may regulate b cell receptor-mediated gene activation through Vav proteins.
15182247 Vav1 alone is a poor activator of the JNK1 pathway in T cells
14757747 although both Vav proteins are biochemically coupled to the T cell antigen receptor, they regulate distinct molecular pathways leading to defined gene transcriptional events.
14709332 Vav functions as an adaptor protein responsible of targeting PI 3-K to its intranuclear substrates.
14597672 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
12917349 Vav1 trapping was independent of actin polymerization, suggesting that inhibition of cellular cytotoxicity occurs through an early dephosphorylation of Vav1 by SHP-1, which blocks actin-dependent activation signals.
12885870 Data show that engagement of the beta2 integrin LFA-1 on NK cells by intercellular adhesion molecule (ICAM)-1 led to phosphorylation of Vav1 that was not sensitive to cholesterol depletion or inhibition of actin polymerization.
12884293 Nef can modify plasma membrane GM1, affecting the behavior of HIV-infected cells towards antigen recognition and Vav towards counteracting such an effect.
12884293 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
12881521 Vav is regulated by Cbl in human and mouse cells
12734410 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
12616499 Vav1 is required for TCR-induced activation of the integrin LFA-1 and cell polarization at the immunological synapse
12496381 A new regulatory role for Vav1 independent of its guanine exchange factor activity has been investigated in integrin-induced T cell spreading.
12393632 presence of a novel protein complex of CrkL, DOCK2, and Vav to regulate Rac1 in leukemia cell lines
12386169 the interaction of Vav1 and Ly-GDI creates a fine tuning mechanism for the regulation of intracellular signaling pathways leading to NFAT stimulation
12234921 Results describe the generation of a Vav-1-deficient Jurkat T-cell line, which exhibits dramatic defects in TCR-dependent interleukin (IL)-2 promoter activation.
12084069 Shb links SLP-76 and Vav with the CD3 complex in Jurkat T cells (SLP-76)
12055221 Vav exchange factor counteracts Leu3a monoclonal antibody-mediated signals inducing apoptosis and mitochondrial damage in Jurkat T cells by decreasing Bax expression.
11859076 mechanisms by which Vav1 can regulate c-fos serum response element transcriptional activity
11716957 In vitro, Vav is a regulated guanine nucleotide dissociation inhibitor for Ras
11525746 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
11463741 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
10394361 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
9438848 Vav is a GEF for Rho, Rac, and Cdc42. Phosphorylation of Vav by Lck activates the GEF activity of Vav; PI 3-kinase enhances this phosphorylation.
9269777 The association of HIV-1 Nef with Vav1, Pak2, and Nck1 is greatly reduced in SLP76-deficient T cells
9013873 Vav associates with Grb2.
9013873 Vav interacts with gp130.
9013873 Vav associates with ERK2.

AA Sequence

MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVNLRPQMSQFL      1 - 70
CLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPIAQNRGIMPFPTEEESVGDED     71 - 140
IYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYT    141 - 210
DTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVY    211 - 280
GRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEA    281 - 350
MEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM    351 - 420
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKTRE    421 - 490
LKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGR    491 - 560
VPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKA    561 - 630
EAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVK    631 - 700
DAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEK    701 - 770
RTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED    771 - 840
YSEYC                                                                     841 - 845
//

Text Mined References (182)

PMID Year Title
26043137 2015 Vav1 Regulates T-Cell Activation through a Feedback Mechanism and Crosstalk between the T-Cell Receptor and CD28.
25539813 2015 Phosphatidylinositol 4-phosphate 5-kinase ? and Vav1 mutual cooperation in CD28-mediated actin remodeling and signaling functions.
25531316 2015 Cross-species epigenetics identifies a critical role for VAV1 in SHH subgroup medulloblastoma maintenance.
25426554 2015 Mutation of Vav1 adaptor region reveals a new oncogenic activation.
25313137 2014 Vav1 promotes lung cancer growth by instigating tumor-microenvironment cross-talk via growth factor secretion.
24905577 2014 Estrogen induces Vav1 expression in human breast cancer cells.
24880064 2014 Vav1 increases Bcl-2 expression by selective activation of Rac2-Akt in leukemia T cells.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24332539 2014 Vav1 as a central regulator of invadopodia assembly.
23856093 2013 VAV1 represses E-cadherin expression through the transactivation of Snail and Slug: a potential mechanism for aberrant epithelial to mesenchymal transition in human epithelial ovarian cancer.
23537630 2013 Dynamin 2 potentiates invasive migration of pancreatic tumor cells through stabilization of the Rac1 GEF Vav1.
23459936 2013 Exploring the genetic basis of chronic periodontitis: a genome-wide association study.
23420881 2013 TCR-driven transendothelial migration of human effector memory CD4 T cells involves Vav, Rac, and myosin IIA.
23342133 2013 Vav1 fine tunes p53 control of apoptosis versus proliferation in breast cancer.
23325923 2013 c-Abl tyrosine kinase plays a critical role in ?2 integrin-dependent neutrophil migration by regulating Vav1 activity.
23271736 2013 The N-terminal 20-amino acid region of guanine nucleotide exchange factor Vav1 plays a distinguished role in T cell receptor-mediated calcium signaling.
23058036 Vav1 haploinsufficiency in a common variable immunodeficiency patient with defective T-cell function.
22864683 2012 Expression of VAV1 in the tumour microenvironment of glioblastoma multiforme.
22534133 2012 Studying the dynamics of SLP-76, Nck, and Vav1 multimolecular complex formation in live human cells with triple-color FRET.
22467863 2012 Radixin regulates cell migration and cell-cell adhesion through Rac1.
22395814 2012 LIME mediates immunological synapse formation through activation of VAV.
22351766 2012 Molecular basis for failure of "atypical" C1 domain of Vav1 to bind diacylglycerol/phorbol ester.
22253833 2012 Human Vav1 expression in hematopoietic and cancer cell lines is regulated by c-Myb and by CpG methylation.
21948080 2011 The p.Arg63Trp polymorphism controls Vav1 functions and Foxp3 regulatory T cell development.
21856460 2011 Nuclear proteome analysis reveals a role of Vav1 in modulating RNA processing during maturation of tumoral promyelocytes.
21756249 2011 EHD2 mediates trafficking from the plasma membrane by modulating Rac1 activity.
21725281 2011 Sequential phosphorylation of SLP-76 at tyrosine 173 is required for activation of T and mast cells.
21647562 2011 Vav1 is a crucial molecule in monocytic/macrophagic differentiation of myeloid leukemia-derived cells.
21632469 2011 Integration of activating and inhibitory receptor signaling by regulated phosphorylation of Vav1 in immune cells.
21386095 2011 Vav1-mediated scaffolding interactions stabilize SLP-76 microclusters and contribute to antigen-dependent T cell responses.
21344162 2011 CDC25A, VAV1, TP73, BRCA1 and ZAP70 gene overexpression correlates with radiation response in colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
21206905 2010 T cell LFA-1 engagement induces HuR-dependent cytokine mRNA stabilization through a Vav-1, Rac1/2, p38MAPK and MKK3 signaling cascade.
21151158 2011 The distinct role of guanine nucleotide exchange factor Vav1 in Bcl-2 transcription and apoptosis inhibition in Jurkat leukemia T cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20598684 2010 Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.
20562827 2010 Cooperative interactions at the SLP-76 complex are critical for actin polymerization.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20189481 2010 Synergistic signals for natural cytotoxicity are required to overcome inhibition by c-Cbl ubiquitin ligase.
20155735 2010 Vav-1 expression correlates with NF?B activation and CD40-mediated cell death in diffuse large B-cell lymphoma cell lines.
20141838 2010 Structural and energetic mechanisms of cooperative autoinhibition and activation of Vav1.
20028078 2010 Mass spectrometry-based identification of Y745 of Vav1 as a tyrosine residue crucial in maturation of acute promyelocytic leukemia-derived cells.
20011522 2009 The use of knockout mice reveals a synergistic role of the Vav1 and Rasgrf2 gene deficiencies in lymphomagenesis and metastasis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19880579 2009 hnRNP-K is a nuclear target of TCR-activated ERK and required for T-cell late activation.
19747912 2010 Vav1 and PU.1 are recruited to the CD11b promoter in APL-derived promyelocytes: role of Vav1 in modulating PU.1-containing complexes during ATRA-induced differentiation.
19597340 2009 IDO inhibits T-cell function through suppressing Vav1 expression and activation.
19234221 2009 c-Abl kinase is required for beta 2 integrin-mediated neutrophil adhesion.
19207108 2009 A Pyk2-Vav1 complex is recruited to beta3-adhesion sites to initiate Rho activation.
19018007 2008 Differential expression and molecular associations of Syk in systemic lupus erythematosus T cells.
18974050 2008 Mechanistic analysis of the amplification and diversification events induced by Vav proteins in B-lymphocytes.
18692475 2008 A protein domain-based interactome network for C. elegans early embryogenesis.
18589439 2008 Structural basis of guanine nucleotide exchange mediated by the T-cell essential Vav1.
18511940 2008 Crucial structural role for the PH and C1 domains of the Vav1 exchange factor.
18295596 2008 CD28 and Grb-2, relative to Gads or Grap, preferentially co-operate with Vav1 in the activation of NFAT/AP-1 transcription.
18160398 2008 Stimulus-dependent regulation of the phagocyte NADPH oxidase by a VAV1, Rac1, and PAK1 signaling axis.
18160397 2008 CD147 inhibits the nuclear factor of activated T-cells by impairing Vav1 and Rac1 downstream signaling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855053 2007 The association of Sam68 with Vav1 contributes to tumorigenesis.
17716865 2007 Glycerophosphoinositol-4-phosphate enhances SDF-1alpha-stimulated T-cell chemotaxis through PTK-dependent activation of Vav.
17590270 2007 Flesh and blood: the story of Vav1, a gene that signals in hematopoietic cells but can be transforming in human malignancies.
17550897 2007 The calponin homology domain of Vav1 associates with calmodulin and is prerequisite to T cell antigen receptor-induced calcium release in Jurkat T lymphocytes.
17306257 2007 Abl-SH3 binding protein 2, 3BP2, interacts with CIN85 and HIP-55.
17275330 2007 Remedial strategies in structural proteomics: expression, purification, and crystallization of the Vav1/Rac1 complex.
17237383 2007 Mitogenic CD28 signals require the exchange factor Vav1 to enhance TCR signaling at the SLP-76-Vav-Itk signalosome.
17060455 2007 The Rac effector p67phox regulates phagocyte NADPH oxidase by stimulating Vav1 guanine nucleotide exchange activity.
17050525 2006 Vav1 acidic region tyrosine 174 is required for the formation of T cell receptor-induced microclusters and is essential in T cell development and activation.
17015707 2006 DOCK2 is required for chemokine-promoted human T lymphocyte adhesion under shear stress mediated by the integrin alpha4beta1.
16728400 2006 Fibrillar beta-amyloid-stimulated intracellular signaling cascades require Vav for induction of respiratory burst and phagocytosis in monocytes and microglia.
16467851 2006 Recruitment and activation of PLCgamma1 in T cells: a new insight into old domains.
16397238 2006 Activation of Vav/Rho GTPase signaling by CXCL12 controls membrane-type matrix metalloproteinase-dependent melanoma cell invasion.
16339550 2005 T cell activation-induced CrkII binding to the Zap70 protein tyrosine kinase is mediated by Lck-dependent phosphorylation of Zap70 tyrosine 315.
16289966 2006 Activation of Epstein-Barr virus/C3d receptor (gp140, CR2, CD21) on human B lymphoma cell surface triggers Cbl tyrosine phosphorylation, its association with p85 subunit, Crk-L and Syk and its dissociation with Vav.
15878332 2005 Vav promotes differentiation of human tumoral myeloid precursors.
15872091 2005 Vav1 and Rac control chemokine-promoted T lymphocyte adhesion mediated by the integrin alpha4beta1.
15850391 2005 Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.
15817684 2005 Defective Vav expression and impaired F-actin reorganization in a subset of patients with common variable immunodeficiency characterized by T-cell defects.
15699036 2005 Beta3 tyrosine phosphorylation and alphavbeta3-mediated adhesion are required for Vav1 association and Rho activation in leukocytes.
15696170 2005 Dynamin 2 regulates T cell activation by controlling actin polymerization at the immunological synapse.
15661896 2005 Kinase-independent functions for Itk in TCR-induced regulation of Vav and the actin cytoskeleton.
15652748 2005 Ectopic expression of VAV1 reveals an unexpected role in pancreatic cancer tumorigenesis.
15618472 2005 Control of lymphocyte shape and the chemotactic response by the GTP exchange factor Vav.
15618286 2005 Novel association of Vav2 and Nek3 modulates signaling through the human prolactin receptor.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15558030 2005 Characterization of VIK-1: a new Vav-interacting Kruppel-like protein.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15345594 2005 The adaptor protein 3BP2 associates with VAV guanine nucleotide exchange factors to regulate NFAT activation by the B-cell antigen receptor.
15182247 2004 Distinct functions of Vav1 in JNK1 activation in Jurkat T cells versus non-haematopoietic cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14757747 2004 Differential regulation of TCR-mediated gene transcription by Vav family members.
14709332 2004 Association of PI 3-K with tyrosine phosphorylated Vav is essential for its activity in neutrophil-like maturation of myeloid cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12917349 2003 Vav1 dephosphorylation by the tyrosine phosphatase SHP-1 as a mechanism for inhibition of cellular cytotoxicity.
12885870 2003 Vav1 phosphorylation is induced by beta2 integrin engagement on natural killer cells upstream of actin cytoskeleton and lipid raft reorganization.
12884293 2003 Vav exchange factor counteracts the HIV-1 Nef-mediated decrease of plasma membrane GM1 and NF-AT activity in T cells.
12881521 2003 Cbl-mediated ubiquitinylation and negative regulation of Vav.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12616499 2003 Vav1 transduces TCR signals required for LFA-1 function and cell polarization at the immunological synapse.
12496381 2003 Guanine exchange-dependent and -independent effects of Vav1 on integrin-induced T cell spreading.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12400014 2002 Adaptor protein APS binds the NH2-terminal autoinhibitory domain of guanine nucleotide exchange factor Vav3 and augments its activity.
12393632 2002 DOCK2 associates with CrkL and regulates Rac1 in human leukemia cell lines.
12386169 2002 Vav1 and Ly-GDI two regulators of Rho GTPases, function cooperatively as signal transducers in T cell antigen receptor-induced pathways.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12234921 2002 Pleiotropic defects in TCR signaling in a Vav-1-null Jurkat T-cell line.
12186560 2002 Phosphorylation of the linker for activation of T-cells by Itk promotes recruitment of Vav.
12084069 2002 Shb links SLP-76 and Vav with the CD3 complex in Jurkat T cells.
12055221 2002 CD4-Lck through TCR and in the absence of Vav exchange factor induces Bax increase and mitochondrial damage.
11859076 2002 Vav1 couples T cell receptor to serum response factor-dependent transcription via a MEK-dependent pathway.
11857085 2002 Differential expression and signaling of CBL and CBL-B in BCR/ABL transformed cells.
11839310 2002 Solution structure of the calponin CH domain and fitting to the 3D-helical reconstruction of F-actin:calponin.
11790798 2002 Association of Bcr-Abl with the proto-oncogene Vav is implicated in activation of the Rac-1 pathway.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11390470 2001 Regulation of NK cell-mediated cytotoxicity by the adaptor protein 3BP2.
11368773 2001 Mapping the Zap-70 phosphorylation sites on LAT (linker for activation of T cells) required for recruitment and activation of signalling proteins in T cells.
11331248 2001 Requirement of tyrosine-phosphorylated Vav for morphological differentiation of all-trans-retinoic acid-treated HL-60 cells.
11287617 2001 Vav-Rac1-mediated activation of the c-Jun N-terminal kinase/c-Jun/AP-1 pathway plays a major role in stimulation of the distal NFAT site in the interleukin-2 gene promoter.
11133830 2001 The involvement of the proto-oncogene p120 c-Cbl and ZAP-70 in CD2-mediated T cell activation.
11005864 2000 T-cell receptor antagonists induce Vav phosphorylation by selective activation of Fyn kinase.
10938113 2000 Vav family proteins couple to diverse cell surface receptors.
10867021 2000 Protein-tyrosine kinase Pyk2 is involved in interleukin-2 production by Jurkat T cells via its tyrosine 402.
10790433 2000 Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.
10780782 2000 The human EZH2 gene: genomic organisation and revised mapping in 7q35 within the critical region for malignant myeloid disorders.
10760587 2000 Genomic organization and regulation of the vav proto-oncogene.
10748082 2000 Control of intramolecular interactions between the pleckstrin homology and Dbl homology domains of Vav and Sos1 regulates Rac binding.
10725744 2000 Vav synergizes with protein kinase C theta to mediate IL-4 gene expression in response to CD28 costimulation in T cells.
10713703 2000 Caspase-dependent cleavage and inactivation of the Vav1 proto-oncogene product during apoptosis prevents IL-2 transcription.
10673353 2000 Interferon-alpha signaling promotes nucleus-to-cytoplasmic redistribution of p95Vav, and formation of a multisubunit complex involving Vav, Ku80, and Tyk2.
10669745 2000 Tyrosine phosphorylation mediates both activation and downmodulation of the biological activity of Vav.
10669724 2000 Regulatory and signaling properties of the Vav family.
10664460 2000 Vav, a GDP/GTP nucleotide exchange factor, interacts with GDIs, proteins that inhibit GDP/GTP dissociation.
10662792 2000 Src-like adaptor protein (SLAP) is a negative regulator of T cell receptor signaling.
10620604 2000 The Src homology 2 domain of Vav is required for its compartmentation to the plasma membrane and activation of c-Jun NH(2)-terminal kinase 1.
10394361 1999 Activation of Vav by Nef induces cytoskeletal rearrangements and downstream effector functions.
10347175 1999 SLP-76 and Vav function in separate, but overlapping pathways to augment interleukin-2 promoter activity.
10207103 1999 hSiah2 is a new Vav binding protein which inhibits Vav-mediated signaling pathways.
10022833 1999 Socs1 binds to multiple signalling proteins and suppresses steel factor-dependent proliferation.
9891995 1998 Nuclear association of tyrosine-phosphorylated Vav to phospholipase C-gamma1 and phosphoinositide 3-kinase during granulocytic differentiation of HL-60 cells.
9822663 1998 Fyn and ZAP-70 are required for Vav phosphorylation in T cells stimulated by antigen-presenting cells.
9697839 1998 BLNK: a central linker protein in B cell activation.
9489702 1998 LAT: the ZAP-70 tyrosine kinase substrate that links T cell receptor to cellular activation.
9438848 1998 Role of substrates and products of PI 3-kinase in regulating activation of Rac-related guanosine triphosphatases by Vav.
9400828 1997 Bacterial LPS and IFN-gamma trigger the tyrosine phosphorylation of vav in macrophages: evidence for involvement of the hck tyrosine kinase.
9399639 1997 Cbl-b, a member of the Sli-1/c-Cbl protein family, inhibits Vav-mediated c-Jun N-terminal kinase activation.
9341187 1997 Identification of two tyrosine phosphoproteins, pp70 and pp68, which interact with phospholipase Cgamma, Grb2, and Vav after B cell antigen receptor activation.
9201297 1997 The SH3 domain of Bruton's tyrosine kinase interacts with Vav, Sam68 and EWS.
9200440 1997 Proto-oncoprotein Vav interacts with c-Cbl in activated thymocytes and peripheral T cells.
9162069 1997 Role of the vav proto-oncogene product (Vav) in erythropoietin-mediated cell proliferation and phosphatidylinositol 3-kinase activity.
9115846 1996 Structure and function of vav.
9047237 1997 Regulation of Vav-SLP-76 binding by ZAP-70 and its relevance to TCR zeta/CD3 induction of interleukin-2.
9032261 1997 Lck regulates Vav activation of members of the Rho family of GTPases.
9013873 1997 Vav is associated with signal transducing molecules gp130, Grb2 and Erk2, and is tyrosine phosphorylated in response to interleukin-6.
8990121 1997 Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.
8986718 1996 Functional and physical interactions of Syk family kinases with the Vav proto-oncogene product.
8900182 1996 Association of a p95 Vav-containing signaling complex with the FcepsilonRI gamma chain in the RBL-2H3 mast cell line. Evidence for a constitutive in vivo association of Vav with Grb2, Raf-1, and ERK2 in an active complex.
8673706 1996 Vav and SLP-76 interact and functionally cooperate in IL-2 gene activation.
8649418 1996 Interaction of Vav with ENX-1, a putative transcriptional regulator of homeobox gene expression.
8632004 1996 The tyrosine phosphatase PTP1C associates with Vav, Grb2, and mSos1 in hematopoietic cells.
8622875 1996 SH3 domain-dependent interaction of the proto-oncogene product Vav with the focal contact protein zyxin.
8621483 1996 Sos, Vav, and C3G participate in B cell receptor-induced signaling pathways and differentially associate with Shc-Grb2, Crk, and Crk-L adaptors.
8570203 1996 Association of CD45 with Lck and components of the Ras signalling pathway in pervanadate-treated mouse T-cell lines.
8554611 1995 Molecular analysis of Ras activation by tyrosine phosphorylated Vav.
8530437 1995 Interactions between the protein-tyrosine kinase ZAP-70, the proto-oncoprotein Vav, and tubulin in Jurkat T cells.
8524317 1996 p95vav associates with the nuclear protein Ku-70.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8051112 1994 Novel signaling pathway suggested by SH3 domain-mediated p95vav/heterogeneous ribonucleoprotein K interaction.
7862126 1995 Association of the vav proto-oncogene product with poly(rC)-specific RNA-binding proteins.
7809090 1994 Binding of Vav to Grb2 through dimerization of Src homology 3 domains.
7798261 1994 The protein tyrosine kinase ZAP-70 can associate with the SH2 domain of proto-Vav.
7768923 1995 Vav is necessary for prolactin-stimulated proliferation and is translocated into the nucleus of a T-cell line.
7651724 1995 Interleukin 3 and erythropoietin induce association of Vav with Tec kinase through Tec homology domain.
7535775 1995 Insulin-dependent tyrosine phosphorylation of the vav protooncogene product in cells of hematopoietic origin.
7530656 1995 Tyrosine phosphorylation of p95Vav in myeloid cells is regulated by GM-CSF, IL-3 and steel factor and is constitutively increased by p210BCR/ABL.
7528218 1994 Signaling through CD19 activates Vav/mitogen-activated protein kinase pathway and induces formation of a CD19/Vav/phosphatidylinositol 3-kinase complex in human B cell precursors.
7478592 1995 The proline-rich region of Vav binds to Grb2 and Grb3-3.
2477241 1989 vav, a novel human oncogene derived from a locus ubiquitously expressed in hematopoietic cells.
2069873 1991 Mechanism of activation of the vav protooncogene.
2005887 1991 Loss of the amino-terminal helix-loop-helix domain of the vav proto-oncogene activates its transforming potential.
1565462 1992 The hematopoietically expressed vav proto-oncogene shares homology with the dbl GDP-GTP exchange factor, the bcr gene and a yeast gene (CDC24) involved in cytoskeletal organization.
1375396 1992 Tyrosine phosphorylation of the vav proto-oncogene product in activated B cells.