Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.50
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adrenocortical carcinoma -1.749 4.8e-02
adult high grade glioma -1.500 3.2e-02
Astrocytoma, Pilocytic 1.200 1.9e-03
ependymoma -2.200 3.0e-08
glioblastoma -1.300 1.6e-02
intraductal papillary-mucinous carcinoma... -1.200 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.600 2.7e-03
Pick disease -1.400 2.4e-03
pituitary cancer 2.000 3.0e-03

Gene RIF (1)

AA Sequence

MAKEGVEKAEETEQMIEKEAGKEPAEGGGGDGSHRLGDAQEMRAVVLAGFGGLNKLRLFRKAMPEPQDGE      1 - 70
LKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVC     71 - 140
TPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANLREGMSVLVHSAGGGVGQAVAQLCSTVPNVTVF    141 - 210
GTASTFKHEAIKDSVTHLFDRNADYVQEVKRISAEGVDIVLDCLCGDNTGKGLSLLKPLGTYILYGSSNM    211 - 280
VTGETKSFFSFAKSWWQVEKVNPIKLYEENKVIAGFSLLNLLFKQGRAGLIRGVVEKLIGLYNQKKIKPV    281 - 350
VDSLWALEEVKEAMQRIHDRGNIGKLILDVEKTPTPLMANDSTETSEAGEEEEDHEGDSENKERMPFIQ     351 - 419
//

Text Mined References (9)

PMID Year Title