Property Summary

NCBI Gene PubMed Count 17
PubMed Score 42.85
PubTator Score 33.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.100 6.9e-03
astrocytoma 1.500 5.5e-04
Astrocytoma, Pilocytic 1.100 2.9e-04
atypical teratoid / rhabdoid tumor 1.600 2.4e-09
breast carcinoma -1.100 8.6e-04
glioblastoma 1.300 7.0e-04
group 4 medulloblastoma 1.300 2.7e-03
medulloblastoma, large-cell 1.400 1.8e-05
osteosarcoma -1.376 4.2e-04
posterior fossa group A ependymoma 1.100 9.2e-06
primitive neuroectodermal tumor 1.400 1.9e-04
subependymal giant cell astrocytoma 2.237 1.2e-03

Gene RIF (5)

AA Sequence

MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYDKVKLQSRPAA      1 - 70
PPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIAVGEGVSDRKAGDRVMVLNRS     71 - 140
GMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVHMAAGGVGMAAVQLCR    141 - 210
TVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMG    211 - 280
KVVTYGMANLLTGPKRNLMALARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYN    281 - 350
QGHIKPHIDSVWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN                               351 - 393
//

Text Mined References (26)

PMID Year Title