Property Summary

NCBI Gene PubMed Count 14
PubMed Score 17.54
PubTator Score 9.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma, Hepatocellular 228 0.0 0.0
Disease Target Count
Liver carcinoma 240
Disease Target Count Z-score Confidence
Radiculopathy 14 3.214 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.125 4.8e-03
astrocytic glioma -1.300 1.3e-02
group 3 medulloblastoma -1.400 7.9e-03
medulloblastoma, large-cell -1.300 6.4e-04
osteosarcoma 1.375 9.4e-03
ovarian cancer 1.400 1.5e-05
spina bifida -1.824 3.7e-02

Gene RIF (2)

AA Sequence

MCSRVPLLLPLLLLLALGPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPDTVGLYVFENGITMLDAG      1 - 70
SFAGLPGLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETFRGLRRLERLYLGKNRIRHIQ     71 - 140
PGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNSLLALEPGILDTANVEALRLAGLGLQQLDEG    141 - 210
LFSRLRNLHDLDVSDNQLERVPPVIRGLRGLTRLRLAGNTRIAQLRPEDLAGLAALQELDVSNLSLQALP    211 - 280
GDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCP    281 - 350
ATTTTATVPTTRPVVREPTALSSSLAPTWLSPTEPATEAPSPPSTAPPTVGPVPQPQDCPPSTCLNGGTC    351 - 420
HLGTRHHLACLCPEGFTGLYCESQMGQGTRPSPTPVTPRPPRSLTLGIEPVSPTSLRVGLQRYLQGSSVQ    421 - 490
LRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVH    491 - 560
SNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAAYCVRRGRAMAAAAQDKGQVGPGAGPLELEGVKVP    561 - 630
LEPGPKATEGGGEALPSGSECEVPLMGFPGPGLQSPLHAKPYI                               631 - 673
//

Text Mined References (18)

PMID Year Title