Property Summary

NCBI Gene PubMed Count 24
PubMed Score 21.89
PubTator Score 10.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.200 1.8e-03
atypical teratoid/rhabdoid tumor 1.600 7.5e-03
Duchenne muscular dystrophy 1.178 1.0e-05
glioblastoma 1.600 4.0e-05
group 3 medulloblastoma 4.600 1.2e-09
interstitial cystitis 1.100 3.4e-03
juvenile dermatomyositis 1.097 2.0e-04
malignant mesothelioma 1.600 1.5e-05
medulloblastoma, large-cell 1.500 1.5e-05
nasopharyngeal carcinoma 1.400 5.6e-03
non primary Sjogren syndrome sicca -1.200 2.2e-02
osteosarcoma 1.139 6.2e-05
pituitary cancer -1.500 1.5e-02
primitive neuroectodermal tumor 2.700 6.5e-03
psoriasis -1.700 5.6e-04
tuberculosis -1.200 3.1e-04

Gene RIF (17)

AA Sequence

MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHV      1 - 70
AKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLS     71 - 140
GLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMS    141 - 210
RRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIR    211 - 280
KELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVG    281 - 350
YQIRI                                                                     351 - 355
//

Text Mined References (26)

PMID Year Title