Property Summary

NCBI Gene PubMed Count 43
PubMed Score 411.81
PubTator Score 69.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.093 2.7e-03
Multiple myeloma 1.109 2.3e-04
osteosarcoma 1.610 3.1e-05
ependymoma -1.200 2.7e-06
glioblastoma -2.300 7.0e-06
atypical teratoid / rhabdoid tumor -2.200 9.9e-07
medulloblastoma -1.100 1.0e-04
medulloblastoma, large-cell -2.400 2.9e-07
tuberculosis and treatment for 6 months 1.200 4.3e-05
non-small cell lung cancer -2.209 1.1e-29
breast carcinoma 1.200 4.8e-03
adult high grade glioma -2.000 3.2e-05
psoriasis -1.100 4.9e-27
subependymal giant cell astrocytoma -2.371 3.5e-02
Breast cancer -1.500 3.2e-14
invasive ductal carcinoma -1.800 1.6e-03
ovarian cancer -2.700 7.2e-17

Gene RIF (17)

PMID Text
26490117 Our work revealed that VAP-A/B knockdown impaired the processing and secretion of PAUF, which is one of the cargo proteins of carriers of the trans-Golgi network to the cell surface.
25681634 The effects of sterol manipulation of HuH7 cells on complexes of established sterol-binding Oxysterol-binding protein related proteins with their endoplasmic reticulum receptor, VAMP-associated protein A (VAPA), were examined.
25447204 phosphorylation of ORP3 controls its association with VAPA. Furthermore, ORP3-VAPA complexes stimulate R-Ras signaling.
24569996 phosphorylation of CERT at the FFAT motif-adjacent serine affects its affinity for VAP, which may regulate the inter-organelle trafficking of ceramide in response to the perturbation of cellular sphingomyelin and/or other sphingolipids
24223774 GPS2 is required for the association of viral NS5A with VAP-A and hepatitis C virus replication.
24105263 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the endoplasmic reticulum.
22190034 HIV-1 gp41 is identified to have a physical interaction with VAMP (vesicle-associated membrane protein)-associated protein A (VAPA) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21957124 Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein VAP-33.
21152411 Data show that the methylated VAPA-APCDD1 DNA in maternal plasma is predominantly derived from the fetus, and this novel fetal epigenetic marker in maternal plasma is useful for the noninvasive detection of fetal trisomy 18.
21144830 three conserved prolines in VAPA and Scs2p confers less vulnerability to mutations equivalent to the amyotrophic lateral sclerosis causing mutation as compared with VAPB, which has only two conserved prolines.
20178991 Electrostatic interaction between oxysterol-binding protein and VAMP-associated protein A revealed by NMR and mutagenesis studies.
19665998 GLTP and VAP-A were shown to interact.
19289470 VAP-A is an important regulator both of the subcellular localization of protrudin and of its ability to stimulate neurite outgrowth.
18713837 Data show that overexpression of VAPA and VAPB causes retention of ER membrane proteins by impeding lateral diffusion and their incorporation into transport vesicles.
18665321 Our results provide suggestive evidence of an association between SNPs in the 3'UTR of the VAPA gene and bipolar disorder.
18665321 Observational study of gene-disease association. (HuGE Navigator)
15016871 protein-protein interactions among the various HCV NS proteins and hVAP-33 are important for the formation of HCV replication complex

AA Sequence

MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP      1 - 70
GSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN     71 - 140
DMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSD    141 - 210
KPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL                                   211 - 249
//

Text Mined References (51)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26490117 2015 CARTS biogenesis requires VAP-lipid transfer protein complexes functioning at the endoplasmic reticulum-Golgi interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25681634 2015 Sterol liganding of OSBP-related proteins (ORPs) regulates the subcellular distribution of ORP-VAPA complexes and their impacts on organelle structure.
25616068 2015 A combined proteomics/genomics approach links hepatitis C virus infection with nonsense-mediated mRNA decay.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25447204 2015 OSBP-related protein 3 (ORP3) coupling with VAMP-associated protein A regulates R-Ras activity.
24569996 2014 Phosphoregulation of the ceramide transport protein CERT at serine 315 in the interaction with VAMP-associated protein (VAP) for inter-organelle trafficking of ceramide in mammalian cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223774 2013 GPS2 is required for the association of NS5A with VAP-A and hepatitis C virus replication.
24209621 2013 A four-step cycle driven by PI(4)P hydrolysis directs sterol/PI(4)P exchange by the ER-Golgi tether OSBP.
24105263 2013 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER.
23935497 2013 Rab18 binds to hepatitis C virus NS5A and promotes interaction between sites of viral replication and lipid droplets.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23736259 2013 The ALS8 protein VAPB interacts with the ER-Golgi recycling protein YIF1A and regulates membrane delivery into dendrites.
23601107 2013 The antiviral effector IFITM3 disrupts intracellular cholesterol homeostasis to block viral entry.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21976701 2011 Protrudin serves as an adaptor molecule that connects KIF5 and its cargoes in vesicular transport during process formation.
21957124 2012 Viperin inhibits hepatitis C virus replication by interfering with binding of NS5A to host protein hVAP-33.
21269460 2011 Initial characterization of the human central proteome.
21152411 2010 Systematic identification of placental epigenetic signatures for the noninvasive prenatal detection of Edwards syndrome.
21144830 2011 Human VAPA and the yeast VAP Scs2p with an altered proline distribution can phenocopy amyotrophic lateral sclerosis-associated VAPB(P56S).
20178991 2010 Electrostatic interaction between oxysterol-binding protein and VAMP-associated protein A revealed by NMR and mutagenesis studies.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19665998 2009 The glycolipid transfer protein interacts with the vesicle-associated membrane protein-associated protein VAP-A.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19515777 2009 Human VAP-C negatively regulates hepatitis C virus propagation.
19289470 2009 Promotion of neurite extension by protrudin requires its interaction with vesicle-associated membrane protein-associated protein.
18713837 2008 FFAT rescues VAPA-mediated inhibition of ER-to-Golgi transport and VAPB-mediated ER aggregation.
18665321 2008 Association between polymorphisms in the vesicle-associated membrane protein-associated protein A (VAPA) gene on chromosome 18p and bipolar disorder.
18165232 2008 Protein phosphatase 2Cepsilon is an endoplasmic reticulum integral membrane protein that dephosphorylates the ceramide transport protein CERT to enhance its association with organelle membranes.
18160438 2008 Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16996479 2006 Subproteomic study of hepatitis C virus replicon reveals Ras-GTPase-activating protein binding protein 1 as potential HCV RC component.
16895911 2006 Efficient trafficking of ceramide from the endoplasmic reticulum to the Golgi apparatus requires a VAMP-associated protein-interacting FFAT motif of CERT.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16227268 2005 Human VAP-B is involved in hepatitis C virus replication through interaction with NS5A and NS5B.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16143324 2005 Targeting of OSBP-related protein 3 (ORP3) to endoplasmic reticulum and plasma membrane is controlled by multiple determinants.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15016871 2004 Interactions between viral nonstructural proteins and host protein hVAP-33 mediate the formation of hepatitis C virus RNA replication complex on lipid raft.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11511104 2001 VAP-A binds promiscuously to both v- and tSNAREs.
10544080 1999 Hepatitis C virus RNA polymerase and NS5A complex with a SNARE-like protein.
10523508 1999 VAP-33 localizes to both an intracellular vesicle population and with occludin at the tight junction.
9920726 1999 Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins.
9657962 1998 Identification of a human homologue of the vesicle-associated membrane protein (VAMP)-associated protein of 33 kDa (VAP-33): a broadly expressed protein that binds to VAMP.