Property Summary

NCBI Gene PubMed Count 22
PubMed Score 182.34
PubTator Score 47.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Protein-protein Interaction (4)

Gene RIF (13)

PMID Text
26754771 VANGL2 is overexpressed in basal breast cancers. It is involved in the proliferative signal cascade of the VANGL2-SQSTM1-JNK pathway.
25627785 Asymmetry of VANGL2 in migrating lymphocytes as a tool to monitor activity of the mammalian WNT/planar cell polarity pathway.
25200836 The aberrant VANGL2 promoter methylation and the decreased gene expression is associated with Tetralogy of Fallot.
25068569 These results strongly suggest that R181 and R274 play critical roles in Vangl protein function and that their mutations cause neural tube defects in humans.
23579212 Van-Gogh-like 2 is frequently methylated in MSI-CRCs with BRAF mutation and may act as a tumour suppressor gene, counteracting WNT/beta-catenin signaling.
23326640 Propose that Arfrp1 exposes a binding site on AP-1 that recognizes the Vangl2 sorting motif for capture into a transport vesicle destined for the proximal surface of a polarized epithelial cell.
21142127 Loss of membrane targeting of Vangl1 and Vangl2 proteins causes neural tube defects.
20738329 these findings strongly implicate VANGL2 in the genetic causation of spinal NTDs in a subset of patients and provide additional evidence for a pathogenic role of PCP signaling in these malformations.
20558380 Observational study of gene-disease association. (HuGE Navigator)
20558380 identified 3 novel missense mutations in fetuses with neural-tube defects
20223754 The planar cell polarity genes Celsr1 and Vangl2 are required for normal lung branching morphogenesis.
19577357 Van Gogh-Like 2 regulates tumor cell migration and matrix metalloproteinase-dependent invasion.
18034999 Results suggest that there is no specific mutation responsible for the Tetralogy of Fallot phenotype in the Vangl2 gene [Vangl2].

AA Sequence

MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTRGDERDDNWGE      1 - 70
TTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSFLTPLAFLLLPPLLWREELEP     71 - 140
CGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFVLRALLMVLVFLLVVSYWLFYGVRILDARER    141 - 210
SYQGVVQFAVSLVDALLFVHYLAVVLLELRQLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYY    211 - 280
HDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHER    281 - 350
RVRKRRARLVVAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI    351 - 420
LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLLKRQDFSLVVS    421 - 490
TKKVPFFKLSEEFVDPKSHKFVMRLQSETSV                                           491 - 521
//

Text Mined References (22)

PMID Year Title
26754771 2016 Identification of p62/SQSTM1 as a component of non-canonical Wnt VANGL2-JNK signalling in breast cancer.
25627785 2015 Asymmetry of VANGL2 in migrating lymphocytes as a tool to monitor activity of the mammalian WNT/planar cell polarity pathway.
25200836 2014 Promoter methylation and expression of the VANGL2 gene in the myocardium of pediatric patients with tetralogy of fallot.
25068569 2014 Independent mutations at Arg181 and Arg274 of Vangl proteins that are associated with neural tube defects in humans decrease protein stability and impair membrane targeting.
23579212 2013 Van-Gogh-like 2 antagonises the canonical WNT pathway and is methylated in colorectal cancers.
23326640 2013 A novel GTP-binding protein-adaptor protein complex responsible for export of Vangl2 from the trans Golgi network.
22610794 2012 Identification of novel rare mutations of DACT1 in human neural tube defects.
21142127 2011 Loss of membrane targeting of Vangl proteins causes neural tube defects.
20738329 2011 Contribution of VANGL2 mutations to isolated neural tube defects.
20558380 2010 VANGL2 mutations in human cranial neural-tube defects.
20223754 2010 The PCP genes Celsr1 and Vangl2 are required for normal lung branching morphogenesis.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
19577357 2010 The planar cell polarity protein Van Gogh-Like 2 regulates tumor cell migration and matrix metalloproteinase-dependent invasion.
18849982 2008 Planar polarization in embryonic epidermis orchestrates global asymmetric morphogenesis of hair follicles.
18034999 Mutation analysis of the Vangl2 coding region revealed no common cause for Tetralogy of Fallot.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15195140 2004 MAGI-3 is involved in the regulation of the JNK signaling pathway as a scaffold protein for frizzled and Ltap.
12490194 2003 Runnin' with the Dvl: proteins that associate with Dsh/Dvl and their significance to Wnt signal transduction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11431695 2001 Ltap, a mammalian homolog of Drosophila Strabismus/Van Gogh, is altered in the mouse neural tube mutant Loop-tail.
10574462 1999 Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.