Property Summary

NCBI Gene PubMed Count 29
PubMed Score 72.18
PubTator Score 32.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (24)

PMID Text
26914375 We first propose the use of a DNA biosensor to detect the missense single nucleotide polymorphism (rs4839469 c.346G>A p.Ala116Thr) of the vangl1 gene
26735870 a novel and ultrasensitive sandwich-type immunosensor was fabricated to detect Vangl in human serum using C60-templated AuPt as labels and rGO-TEPA-PTC-NH2 as the platform.
26496979 Results found that KITENIN is associated with tumor progression by enhancing angiogenesis in colorectal cancer.
25874746 Authors silenced VANGL1 gene expression in the HepG2 HCC cell line by stable transfection with a vector containing siRNA template for VANGL1 and investigated the change in cell invasion and motility.
25605251 High levels of KITENIN increased glioma invasiveness and progression, and are associated with the up-regulation of EMT and stemness markers.
25208524 VANGL1 mutations are associated with neural tube defects.
25068569 These results strongly suggest that R181 and R274 play critical roles in Vangl protein function and that their mutations cause neural tube defects in humans.
24909917 Findings identify that KITENIN-targeting miR-124, miR-27a, and miR-30b function as endogenous inhibitors of colorectal cancer cell motility and demonstrate that miR-124 plays a suppressor role in colorectal tumorigenesis.
24893630 Elevated KITENIN expression is associated with drug resistance in colorectal cancer.
24452931 The results show that the Vangl1 amino terminus lacks PM targeting determinants, and these are restricted to the carboxy terminus, including the predicted PDZBM motif at the C-terminus
24407469 The rs4839469 allele of VANGL1 was obviously associated with neural tube defects (NTDs). And genotype GC increased the risk of NTDs, changes in the three-dimensional protein structure may have impacted its biological functions.
22840317 KITENIN is associated with tumor invasiveness and metastasis in human oral cavity squamous cell carcinoma.
22179838 NOS1AP colocalizes with both SCRIB and VANGL1 along cellular protrusions in metastatic breast cancer cells, but does not colocalize with either SCRIB or VANGL1 at cell junctions in normal breast cells
21418393 KITENIN is associated with human colorectal cancer progression including invasion and metastasis.
21291170 a compact membrane-associated portion with very short predicted extra- and intracellular loops, while the protein harbors a large intracellular domain
21142127 Loss of membrane targeting of Vangl1 and Vangl2 proteins causes neural tube defects.
20944126 KITENIN plays an important role in human gastric cancer progression by AP-1 activation.
20043994 This study demonstrates a high degree of functional conservation of VANGL genes across evolution and provides a model system for studying potential variants identified in human neural tube defects.
19319979 role of VANGL1 as a risk factor in the development of spinal neural tube defects
19319979 Observational study of gene-disease association. (HuGE Navigator)
19166844 VANGL1 increases invasion and migration of mouse squamous cancer cells and promotes pulmonary metastasis in a mouse squamous tumor model.
17409324 In a protein-protein interaction assay V239I abolished interaction of VANGL1 protein with its binding partners, disheveled-1, -2, and -3. These findings implicate VANGL1 as a risk factor in human neural-tube defects.
16410243 VANGL protein may serve as an effector mediating the intestinal trefoil factor (ITF) healing response of the intestinal mucosa.
11956595 Molecular cloning and characterization of Strabismus 2

AA Sequence

MDTESTYSGYSYYSSHSKKSHRQGERTRERHKSPRNKDGRGSEKSVTIQPPTGEPLLGNDSTRTEEVQDD      1 - 70
NWGETTTAITGTSEHSISQEDIARISKDMEDSVGLDCKRYLGLTVASFLGLLVFLTPIAFILLPPILWRD     71 - 140
ELEPCGTICEGLFISMAFKLLILLIGTWALFFRKRRADMPRVFVFRALLLVLIFLFVVSYWLFYGVRILD    141 - 210
SRDRNYQGIVQYAVSLVDALLFIHYLAIVLLELRQLQPMFTLQVVRSTDGESRFYSLGHLSIQRAALVVL    211 - 280
ENYYKDFTIYNPNLLTASKFRAAKHMAGLKVYNVDGPSNNATGQSRAMIAAAARRRDSSHNELYYEEAEH    281 - 350
ERRVKKRKARLVVAVEEAFIHIQRLQAEEQQKAPGEVMDPREAAQAIFPSMARALQKYLRITRQQNYHSM    351 - 420
ESILQHLAFCITNGMTPKAFLERYLSAGPTLQYDKDRWLSTQWRLVSDEAVTNGLRDGIVFVLKCLDFSL    421 - 490
VVNVKKIPFIILSEEFIDPKSHKFVLRLQSETSV                                        491 - 524
//

Text Mined References (33)

PMID Year Title
26914375 2016 A novel DNA biosensor integrated with Polypyrrole/streptavidin and Au-PAMAM-CP bionanocomposite probes to detect the rs4839469 locus of the vangl1 gene for dysontogenesis prediction.
26735870 2016 A novel electrochemical immunosensor based on the rGO-TEPA-PTC-NH? and AuPt modified C?? bimetallic nanoclusters for the detection of Vangl1, a potential biomarker for dysontogenesis.
26496979 2016 Impact of KITENIN on tumor angiogenesis and lymphangiogenesis in colorectal cancer.
25874746 2015 Downregulation of VANGL1 inhibits cellular invasion rather than cell motility in hepatocellular carcinoma cells without stimulation.
25605251 2015 KITENIN promotes glioma invasiveness and progression, associated with the induction of EMT and stemness markers.
25208524 2015 Expanding the mutational spectrum associated to neural tube defects: literature revision and description of novel VANGL1 mutations.
25068569 2014 Independent mutations at Arg181 and Arg274 of Vangl proteins that are associated with neural tube defects in humans decrease protein stability and impair membrane targeting.
24909917 2014 KITENIN-targeting microRNA-124 suppresses colorectal cancer cell motility and tumorigenesis.
24893630 2014 An unconventional KITENIN/ErbB4-mediated downstream signal of EGF upregulates c-Jun and the invasiveness of colorectal cancer cells.
24452931 2014 The intracellular carboxyl terminal domain of Vangl proteins contains plasma membrane targeting signals.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24407469 2014 Association between VANGL1 gene polymorphisms and neural tube defects.
22840317 2013 Expression of KITENIN and its association with tumor progression in oral squamous cell carcinoma.
22179838 2012 A protein complex of SCRIB, NOS1AP and VANGL1 regulates cell polarity and migration, and is associated with breast cancer progression.
21418393 2011 Expression of KITENIN in human colorectal cancer and its relation to tumor behavior and progression.
21291170 2011 Transmembrane topology of mammalian planar cell polarity protein Vangl1.
21142127 2011 Loss of membrane targeting of Vangl proteins causes neural tube defects.
20944126 2010 KITENIN is associated with tumor progression in human gastric cancer.
20043994 VANGL1 rare variants associated with neural tube defects affect convergent extension in zebrafish.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19319979 2009 Novel mutations in VANGL1 in neural tube defects.
19166844 2009 KITENIN increases invasion and migration of mouse squamous cancer cells and promotes pulmonary metastasis in a mouse squamous tumor model.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17409324 2007 Mutations in VANGL1 associated with neural-tube defects.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16410243 2006 Vangl1 protein acts as a downstream effector of intestinal trefoil factor (ITF)/TFF3 signaling and regulates wound healing of intestinal epithelium.
15952208 2005 Analysis of the planar cell polarity gene Vangl2 and its co-expressed paralogue Vangl1 in neural tube defect patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205336 2004 KAI1 COOH-terminal interacting tetraspanin (KITENIN), a member of the tetraspanin family, interacts with KAI1, a tumor metastasis suppressor, and enhances metastasis of cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011995 2002 Isolation and characterization of a novel human gene, VANGL1, as a therapeutic target for hepatocellular carcinoma.
11956595 2002 Molecular cloning and characterization of Strabismus 2 (STB2).