Property Summary

NCBI Gene PubMed Count 55
PubMed Score 64.58
PubTator Score 104.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.425 9.5e-03
astrocytoma 1.100 6.4e-07
Astrocytoma, Pilocytic 1.500 4.0e-06
Duchenne muscular dystrophy 1.063 3.6e-09
ductal carcinoma in situ 1.400 7.4e-04
ependymoma 1.100 9.2e-05
glioblastoma 1.100 1.4e-02
invasive ductal carcinoma 1.417 1.2e-02
juvenile dermatomyositis 1.339 5.1e-07
lung cancer -1.600 1.4e-04
lung carcinoma -2.000 8.9e-32
malignant mesothelioma -1.100 8.5e-06
medulloblastoma, large-cell -1.600 1.2e-03
Multiple myeloma 1.539 3.7e-03
osteosarcoma -2.492 2.9e-04
ovarian cancer -1.600 6.2e-05
pediatric high grade glioma 1.200 1.7e-02
pituitary cancer -1.700 6.9e-05
tuberculosis 1.300 8.1e-07
Waldenstrons macroglobulinemia 1.903 4.8e-03

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW      1 - 70
WKNVKMIVLICVIVFIIILFIVLFATGAFS                                             71 - 100
//

Text Mined References (59)

PMID Year Title