Property Summary

NCBI Gene PubMed Count 66
PubMed Score 81.72
PubTator Score 65.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 2.270 1.6e-03
psoriasis 1.700 5.8e-05
medulloblastoma, large-cell -1.300 3.9e-04
pancreatic ductal adenocarcinoma liver m... -1.679 6.5e-03
ovarian cancer -2.000 5.0e-08

Gene RIF (36)

PMID Text
26553929 GLUT5 required an interaction cascade of Rab11, Myo5B, Slp4a, Munc18-2, and Vamp7 with Stx3.
25999457 VAMP-7 participates in both platelet granule secretion and spreading and suggest a mechanism whereby VAMP-7 links granule exocytosis with actin reorganization.
25046114 highlight the role that VAMP3 and VAMP7 play in selection of the pathways leading to generation of ultrastructurally different LC3 compartments
24880616 increased gene dosage of VAMP7, and thus higher expression levels of its protein product, enhances estrogen receptor action in male genitourinary tissues
24807903 Increased level of SNAP23-Syntaxin4-VAMP7 interaction correlates with decreased Syntaxin4 phosphorylation and trafficking of MT1-MMP to invadopodia during cellular invasion.
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
23741335 CALM is able to sort VAMP4 and VAMP7, even though they have sorting signals for other clathrin adaptors.
23471971 Activation of TI-VAMP-mediated exocytosis thus relies on tyrosine phosphorylation.
23322049 hVps41 and VAMP7 are specifically involved in the fusion of trans-Golgi network-derived lysosome-associated membrane protein carriers with late endosomes.
23217169 Overexpression of Vamp7 inhibited the heterotypic fusion with lysosomes and the homotypic fusion between individual Coxiella phagosomes and replicative vacuoles.
23104059 VAMP7-SNARE motif is trapped between Varp and the VAMP7 longin domain, and hence Varp kinetically inhibits the ability of VAMP7 to form SNARE complexes
22951367 In a mammalian tumor cell line a subset of VAMP7 (V-SNARE)-positive vacuoles colocalize with LC3 at the cell periphery (focal adhesions) upon starvation.
22589474 These studies identify a new alpha-granule subtype expressing VAMP-7 that moves to the periphery during spreading, supporting the premise that alpha-granules are heterogeneous and demonstrating that granule exocytosis is required for platelet spreading.
22323709 Behavioral characterization studies indicate that deletion of Vamp7 exon 7 is associated with a role for VAMP7 in higher brain functions.
22188132 Downregulation of VAMP7 expression inhibited the fusion of ATP-storing vesicles and ATP-mediated calcium wave propagation.
22002060 The endosomal trafficking and recycling of MT1-MMP was found to be dependent upon Rab7 and VAMP7, and blocking the function of these proteins reduced cell migration and invasion.
21805468 VAMP7 is involved in many fusion processes and thus plays a more general function in NK-cell activity than VAMP4.
21609427 Alternative splicing of SYBL1 by exon skipping events results in the production of a number of VAMP7 isoforms.
20378544 SNARE VAMP7/TI-VAMP adopts a closed conformation
20144992 Results highlight the role of TI-VAMP in the secretory pathway of a tetraspanin, and support a model in which CD82 allows EGFR entry in microdomains that control its clathrin-dependent endocytosis and signaling.
19781582 TI-VAMP/VAMP7 and VAMP3/cellubrevin: two v-SNARE proteins involved in specific steps of the autophagy/multivesicular body pathways.
19745841 show that TI-VAMP interacts with the Vps9 domain and ankyrin-repeat-containing protein Varp, a guanine nucleotide exchange factor of the small GTPase Rab21, through a specific domain herein called the interacting domain.
19451649 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
19138172 The present results suggest that a SNARE complex containing VAMP7 and Vti1a defines a novel traffic pathway to the cell surface in both neuronal and non-neuronal cells.
18819912 HRB is involved in clathrin-dependent endocytosis and recruits TI-VAMP in this process
18775314 Study demonstrates that the clathrin-mediated endocytosis of the SNARE VAMP7 is directly mediated by Hrb, a clathrin adaptor and ArfGAP.
18571410 Collectively, these data point to a specific role of VAMP7 in delivering MT1-MMP to sites of matrix degradation, maintaining the functional machinery required for invasion.
18362137 The participation of vesicle-associated membrane protein 7 as a partner of syntaxin 7 in VacA-induced vacuole formation is reported.
18253931 Data show that mature human mast cells express a specific pattern of SNARE and that VAMP-7 and VAMP-8, but not VAMP-2, are required for rapid degranulation.
18042464 Our results show that VAMP-7 is a crucial component of granzyme B release and target cell killing in the NK cell line YT-Indy.
16430921 Data show that the insensitivity of TI-VAMP to botulinum neurotoxin B relies on at least 12 amino acid changes versus VAMP-2, which are scattered along an interface of 22 amino acid residues in length.
16195891 VAMP-7 is involved in the constitutive exocytosis as a slow, minor v-SNARE, but not in lysosomal transport
14672948 results reported here clarify that a Staf-zinc finger family factor is the major nuclear protein bound to the synaptobrevin-like 1 (SYBL1) promoter region and is responsible for its regulation in HeLa cells
12444103 In ICF (immunodeficiency, centromeric instability, facial abnormalities) syndrome SYBL1 escapes from silencing and this correlates with altered patterns of histone methylation and acetylation.
11840509 Observational study of gene-disease association. (HuGE Navigator)
11840509 A G-->C transversion in a regulatory region was found to be associated with bipolar affective disorder.

AA Sequence

MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDF      1 - 70
ERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIM     71 - 140
VRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCG    141 - 210
GFTWPSCVKK                                                                211 - 220
//

Text Mined References (72)

PMID Year Title
26553929 2015 Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
25999457 2015 VAMP-7 links granule exocytosis to actin reorganization during platelet activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25046114 2014 Role of VAMP3 and VAMP7 in the commitment of Yersinia pseudotuberculosis to LC3-associated pathways involving single- or double-membrane vacuoles.
24880616 2014 Increased gene copy number of VAMP7 disrupts human male urogenital development through altered estrogen action.
24807903 2014 SNAP23, Syntaxin4, and vesicle-associated membrane protein 7 (VAMP7) mediate trafficking of membrane type 1-matrix metalloproteinase (MT1-MMP) during invadopodium formation and tumor cell invasion.
24550300 2014 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23741335 2013 Uncoupling the functions of CALM in VAMP sorting and clathrin-coated pit formation.
23471971 2013 Increased activity of the vesicular soluble N-ethylmaleimide-sensitive factor attachment protein receptor TI-VAMP/VAMP7 by tyrosine phosphorylation in the Longin domain.
23322049 2013 hVps41 and VAMP7 function in direct TGN to late endosome transport of lysosomal membrane proteins.
23217709 2012 The hairpin-type tail-anchored SNARE syntaxin 17 targets to autophagosomes for fusion with endosomes/lysosomes.
23217169 2013 Endocytic SNAREs are involved in optimal Coxiella burnetii vacuole development.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23104059 2012 The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation.
22951367 2012 ATP is released from autophagic vesicles to the extracellular space in a VAMP7-dependent manner.
22589474 2012 Granule exocytosis is required for platelet spreading: differential sorting of ?-granules expressing VAMP-7.
22323709 2012 Absence of TI-VAMP/Vamp7 leads to increased anxiety in mice.
22188132 2012 TI-VAMP/VAMP7 is the SNARE of secretory lysosomes contributing to ATP secretion from astrocytes.
22002060 2011 Phosphorylation of membrane type 1-matrix metalloproteinase (MT1-MMP) and its vesicle-associated membrane protein 7 (VAMP7)-dependent trafficking facilitate cell invasion and migration.
21805468 2011 VAMP4- and VAMP7-expressing vesicles are both required for cytotoxic granule exocytosis in NK cells.
21609427 2011 Alternative splicing of the human gene SYBL1 modulates protein domain architecture of Longin VAMP7/TI-VAMP, showing both non-SNARE and synaptobrevin-like isoforms.
21269460 2011 Initial characterization of the human central proteome.
20378544 2010 The longin SNARE VAMP7/TI-VAMP adopts a closed conformation.
20144992 2010 Role of TI-VAMP and CD82 in EGFR cell-surface dynamics and signaling.
19781582 2009 TI-VAMP/VAMP7 and VAMP3/cellubrevin: two v-SNARE proteins involved in specific steps of the autophagy/multivesicular body pathways.
19745841 2009 Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19138172 2009 A VAMP7/Vti1a SNARE complex distinguishes a non-conventional traffic route to the cell surface used by KChIP1 and Kv4 potassium channels.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18819912 2008 Role of HRB in clathrin-dependent endocytosis.
18775314 2008 Molecular basis for the sorting of the SNARE VAMP7 into endocytic clathrin-coated vesicles by the ArfGAP Hrb.
18571410 2008 MT1-MMP-dependent invasion is regulated by TI-VAMP/VAMP7.
18362137 2008 Involvement of vesicle-associated membrane protein 7 in human gastric epithelial cell vacuolation induced by Helicobacter pylori-produced VacA.
18253931 2008 Vesicle associated membrane protein (VAMP)-7 and VAMP-8, but not VAMP-2 or VAMP-3, are required for activation-induced degranulation of mature human mast cells.
18042464 2008 Vesicle-associated membrane protein 7 (VAMP-7) is essential for target cell killing in a natural killer cell line.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897319 2007 Integral and associated lysosomal membrane proteins.
16677249 2006 A critical role for vesicle-associated membrane protein-7 in exocytosis from human eosinophils and neutrophils.
16495485 2006 Vesicle-associated membrane protein 7 is expressed in intestinal ER.
16430921 2006 Identification of the amino acid residues rendering TI-VAMP insensitive toward botulinum neurotoxin B.
16381901 2006 The LIFEdb database in 2006.
16354670 2006 Involvement of a novel Q-SNARE, D12, in quality control of the endomembrane system.
16195891 2006 Role of VAMP-2, VAMP-7, and VAMP-8 in constitutive exocytosis from HSY cells.
15772651 2005 The DNA sequence of the human X chromosome.
15610015 2004 The variable C-terminus of cysteine string proteins modulates exocytosis and protein-protein interactions.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470500 2004 TI-VAMP/VAMP7 is required for optimal phagocytosis of opsonised particles in macrophages.
15133481 2004 Combinatorial SNARE complexes with VAMP7 or VAMP8 define different late endocytic fusion events.
14993220 2004 Identification of SNAREs involved in synaptotagmin VII-regulated lysosomal exocytosis.
14672948 2004 Human synaptobrevin-like 1 gene basal transcription is regulated through the interaction of selenocysteine tRNA gene transcription activating factor-zinc finger 143 factors with evolutionary conserved cis-elements.
12853575 2003 A dual mechanism controlling the localization and function of exocytic v-SNAREs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444103 2002 Allelic inactivation of the pseudoautosomal gene SYBL1 is controlled by epigenetic mechanisms common to the X and Y chromosomes.
12175335 2002 Syntaxin 7, syntaxin 8, Vti1 and VAMP7 (vesicle-associated membrane protein 7) form an active SNARE complex for early macropinocytic compartment fusion in Dictyostelium discoideum.
11786915 2002 Crystal structure of the endosomal SNARE complex reveals common structural principles of all SNAREs.
11440841 2001 Longins: a new evolutionary conserved VAMP family sharing a novel SNARE domain.
11278762 2001 Syntaxin 7 complexes with mouse Vps10p tail interactor 1b, syntaxin 6, vesicle-associated membrane protein (VAMP)8, and VAMP7 in b16 melanoma cells.
11252894 2000 Three ways to make a vesicle.
11101518 2000 A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10888671 2000 Syntaxin 7 and VAMP-7 are soluble N-ethylmaleimide-sensitive factor attachment protein receptors required for late endosome-lysosome and homotypic lysosome fusion in alveolar macrophages.
10655549 2000 Differentially regulated and evolved genes in the fully sequenced Xq/Yq pseudoautosomal region.
10564831 1999 Human and mouse SYBL1 gene structure and expression.
10459012 1999 VAMP-7 mediates vesicular transport from endosomes to lysosomes.
9614185 1998 A novel tetanus neurotoxin-insensitive vesicle-associated membrane protein in SNARE complexes of the apical plasma membrane of epithelial cells.
8640232 1996 A synaptobrevin-like gene in the Xq28 pseudoautosomal region undergoes X inactivation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6495485 [Method of restoring binocular vision using colored light filters].