Property Summary

NCBI Gene PubMed Count 85
PubMed Score 310.31
PubTator Score 200.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.400 2.7e-02
astrocytic glioma -1.700 3.4e-03
posterior fossa group B ependymoma -2.500 2.2e-10
psoriasis -3.700 3.9e-06
glioblastoma -1.800 1.3e-05
oligodendroglioma -1.200 2.4e-12
osteosarcoma -1.925 3.3e-04
group 3 medulloblastoma -2.500 7.2e-04
lung cancer -1.400 1.3e-04
pediatric high grade glioma -1.200 2.8e-03
atypical teratoid/rhabdoid tumor -1.500 3.3e-05
pilocytic astrocytoma -1.100 1.6e-02
subependymal giant cell astrocytoma -1.867 3.9e-03
Gaucher disease type 1 1.900 2.5e-02

Gene RIF (27)

PMID Text
26639969 This study showed that decreased Levels of VAMP2 correlate with Duration of Dementia.
26412491 A large vesicular pool of VAMP2 maintained by AP180 is crucial to sustain efficient neurotransmission.
26134228 VAMP2-NRG1 is a novel oncogenic fusion gene representing a new addition to the list of NRG1 fusion genes, which together may form an important diagnostic and clinical category of lung adenocarcinoma cases
25481410 miR-206 regulates lung surfactant secretion by limiting the availability of VAMP-2 protein.
25445064 SNARE complex genes and their interactions may play a significant role in susceptibility and working memory of ADHD.
24164654 The genetic variations of VAMP2, Synaptotagmin XI might be indication of the relationship between these genes and idiopathic generalized epilepsy
22172278 BoNT/F5 cleaves substrate synaptobrevin-2 in a different location than the other BoNT/F subtypes, between (54)L and (55)E.
21808019 unique mechanism of SNARE motif-dependent endocytic sorting and identify the ANTH domain proteins AP180 and CALM as cargo-specific adaptors for synaptobrevin 2 endocytosis
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19822142 VAMP2 mediates the trafficking of alpha5beta1 integrin to the plasma membrane and VAMP2-dependent integrin trafficking is critical in cell adhesion, migration and survival.
19557857 Observational study of gene-disease association. (HuGE Navigator)
18628682 These results do not suggest that a common genetic variant at VAMP2 or VAMP3 contributes to the development of bipolar affective disorder in German patients.
18628682 Observational study of gene-disease association. (HuGE Navigator)
18512733 SNARE complex-related genes STX1A, VAMP2 and SNAP25 do not play a major role in susceptibility to schizophrenia in the Japanese population
18512733 Observational study of gene-disease association. (HuGE Navigator)
18511418 analysis of the substrate recognition mechanism of VAMP/synaptobrevin-cleaving clostridial neurotoxins
18511417 BoNT/B and TeNT possess similar organization but have unique residues to recognize and cleave VAMP-2
18182011 Overexpression of CALM leads to the reduction of cell surface VAMP2, whereas knockdown of CALM by RNA interference results in the accumulation of surface VAMP2.
17356306 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17331077 Results indicate that the sorting determinants of synaptic vesicle proteins can operate independently of a neuronal context and implicate the association of VAMP2 with synaptophysin I in the specification of the pathway of synaptic vesicle biogenesis.
17313651 VAMP2 can be phosphorylated by activated PKCzeta in vitro and the presence of ProF increases the PKCzeta-dependent phosphorylation of VAMP2 in vitro
17196367 The vesicular distribution may be attributed in part to the direct interaction between PKD3 and vesicle-associated membrane protein VAMP2, through which PKD3 may regulate VAMP2 vesicle trafficking by facilitating its recruitment to the target membrane.
17001002 addition of PIP2 to Stx4/SNAP23 vesicles inhibited the fusion reaction, and its addition to VAMP2 vesicles was stimulatory
16195891 VAMP-2 can be one of the v-SNAREs for constitutive exocytosis
12517971 VAMP-2 mediates exocytosis of specific and tertiary granules of neutrophils through its interaction with Q-SNARE/R-SNARE complexes located at the neutrophil plasma membrane.
11842301 SNAP-23 and syntaxin-4 are expressed in human eosinophils and are likely candidates for association with VAMP-2 during docking, which is followed by exocytosis

AA Sequence

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADAL      1 - 70
QAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST                             71 - 116
//

Text Mined References (87)

PMID Year Title
26639969 2016 Decreased Levels of VAMP2 and Monomeric Alpha-Synuclein Correlate with Duration of Dementia.
26412491 2015 Vesicular Synaptobrevin/VAMP2 Levels Guarded by AP180 Control Efficient Neurotransmission.
26134228 2015 VAMP2-NRG1 Fusion Gene is a Novel Oncogenic Driver of Non-Small-Cell Lung Adenocarcinoma.
25481410 2015 MicroRNA-206 regulates surfactant secretion by targeting VAMP-2.
25445064 2015 Synaptosome-related (SNARE) genes and their interactions contribute to the susceptibility and working memory of attention-deficit/hyperactivity disorder in males.
25416956 2014 A proteome-scale map of the human interactome network.
24164654 2014 Genetic variants of synaptic vesicle and presynaptic plasma membrane proteins in idiopathic generalized epilepsy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
22172278 2012 Discovery of a novel enzymatic cleavage site for botulinum neurotoxin F5.
22144578 2012 VAMP8 is a vesicle SNARE that regulates mucin secretion in airway goblet cells.
22118466 2011 The molecular basis for the endocytosis of small R-SNAREs by the clathrin adaptor CALM.
21808019 2011 SNARE motif-mediated sorting of synaptobrevin by the endocytic adaptors clathrin assembly lymphoid myeloid leukemia (CALM) and AP180 at synapses.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
19822142 2010 Vesicle-associated membrane protein 2 mediates trafficking of alpha5beta1 integrin to the plasma membrane.
19557857 2009 De novo STXBP1 mutations in mental retardation and nonsyndromic epilepsy.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
19478182 2009 A role for the CHC22 clathrin heavy-chain isoform in human glucose metabolism.
18628682 2008 Association study between genetic variants at the VAMP2 and VAMP3 loci and bipolar affective disorder.
18512733 2008 No association between tagging SNPs of SNARE complex genes (STX1A, VAMP2 and SNAP25) and schizophrenia in a Japanese population.
18511418 2008 Substrate recognition mechanism of VAMP/synaptobrevin-cleaving clostridial neurotoxins.
18511417 2008 Substrate recognition of VAMP-2 by botulinum neurotoxin B and tetanus neurotoxin.
18253931 2008 Vesicle associated membrane protein (VAMP)-7 and VAMP-8, but not VAMP-2 or VAMP-3, are required for activation-induced degranulation of mature human mast cells.
18182011 2008 Evidence for CALM in directing VAMP2 trafficking.
18042464 2008 Vesicle-associated membrane protein 7 (VAMP-7) is essential for target cell killing in a natural killer cell line.
17356306 2006 Association study between vesicle-associated membrane protein 2 gene polymorphisms and fluvoxamine response in Japanese major depressive patients.
17331077 2007 Synaptophysin I selectively specifies the exocytic pathway of synaptobrevin 2/VAMP2.
17313651 2007 WD-repeat-propeller-FYVE protein, ProF, binds VAMP2 and protein kinase Czeta.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17196367 2007 Protein kinase D 3 is localized in vesicular structures and interacts with vesicle-associated membrane protein 2.
17001002 2006 Asymmetric phospholipid distribution drives in vitro reconstituted SNARE-dependent membrane fusion.
16677249 2006 A critical role for vesicle-associated membrane protein-7 in exocytosis from human eosinophils and neutrophils.
16195891 2006 Role of VAMP-2, VAMP-7, and VAMP-8 in constitutive exocytosis from HSY cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15327778 2004 VAMP2-dependent exocytosis regulates plasma membrane insertion of TRPC3 channels and contributes to agonist-stimulated Ca2+ influx.
15217342 2004 The synaptic vesicle cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12855681 2003 Syntaxin 4 and Synip (syntaxin 4 interacting protein) regulate insulin secretion in the pancreatic beta HC-9 cell.
12853575 2003 A dual mechanism controlling the localization and function of exocytic v-SNAREs.
12847087 2003 Hrs regulates early endosome fusion by inhibiting formation of an endosomal SNARE complex.
12773094 2003 A role for Sec1/Munc18 proteins in platelet exocytosis.
12750892 2004 The SLC32 transporter, a key protein for the synaptic release of inhibitory amino acids.
12730201 2003 Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18.
12517971 2003 Role of vesicle-associated membrane protein-2, through Q-soluble N-ethylmaleimide-sensitive factor attachment protein receptor/R-soluble N-ethylmaleimide-sensitive factor attachment protein receptor interaction, in the exocytosis of specific and tertiary granules of human neutrophils.
12485399 2003 The synaptophysin/synaptobrevin interaction critically depends on the cholesterol content.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417022 2002 Trafficking of green fluorescent protein-tagged SNARE proteins in HSY cells.
12200427 2002 Action of complexin on SNARE complex.
12181340 2002 Fluorescence resonance energy transfer detection of synaptophysin I and vesicle-associated membrane protein 2 interactions during exocytosis from single live synapses.
12130530 2002 Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion.
12093152 2002 Munc 18a binding to syntaxin 1A and 1B isoforms defines its localization at the plasma membrane and blocks SNARE assembly in a three-hybrid system assay.
11994746 2002 Regulated transport of the glucose transporter GLUT4.
11842301 2002 Expression of eosinophil target SNAREs as potential cognate receptors for vesicle-associated membrane protein-2 in exocytosis.
11832227 2002 Three-dimensional structure of the complexin/SNARE complex.
11786915 2002 Crystal structure of the endosomal SNARE complex reveals common structural principles of all SNAREs.
11295657 2001 Fusion protein vesicle-associated membrane protein 2 is implicated in IFN-gamma-induced piecemeal degranulation in human eosinophils from atopic individuals.
11278762 2001 Syntaxin 7 complexes with mouse Vps10p tail interactor 1b, syntaxin 6, vesicle-associated membrane protein (VAMP)8, and VAMP7 in b16 melanoma cells.
11252894 2000 Three ways to make a vesicle.
11101518 2000 A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10965122 2000 Genomic organization and assignment of VAMP2 to 17p12 by FISH.
10932255 2000 Cocrystal structure of synaptobrevin-II bound to botulinum neurotoxin type B at 2.0 A resolution.
10713150 2000 Role of SNAP23 in insulin-induced translocation of GLUT4 in 3T3-L1 adipocytes. Mediation of complex formation between syntaxin4 and VAMP2.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
10370136 1999 Tissue expression of the vesicle protein pantophysin.
10336434 1999 Mixed and non-cognate SNARE complexes. Characterization of assembly and biophysical properties.
10100611 1999 A stable interaction between syntaxin 1a and synaptobrevin 2 mediated by their transmembrane domains.
10099709 1999 Genetics of synaptic vesicle function: toward the complete functional anatomy of an organelle.
10036234 1999 Syntaxin 11 is associated with SNAP-23 on late endosomes and the trans-Golgi network.
9920726 1999 Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins.
9817754 1998 Syntaxin 13 mediates cycling of plasma membrane proteins via tubulovesicular recycling endosomes.
9658161 1998 A splice-isoform of vesicle-associated membrane protein-1 (VAMP-1) contains a mitochondrial targeting signal.
9657962 1998 Identification of a human homologue of the vesicle-associated membrane protein (VAMP)-associated protein of 33 kDa (VAP-33): a broadly expressed protein that binds to VAMP.
9341137 1997 Isolation and characterization of a dual prenylated Rab and VAMP2 receptor.
9030619 1997 Effect of mutations in vesicle-associated membrane protein (VAMP) on the assembly of multimeric protein complexes.
8999968 1997 Direct interaction of the rat unc-13 homologue Munc13-1 with the N terminus of syntaxin.
8973549 1996 Identification of SNAP receptors in rat adipose cell membrane fractions and in SNARE complexes co-immunoprecipitated with epitope-tagged N-ethylmaleimide-sensitive fusion protein.
8770861 1996 Syntaxin-4 is localized to the apical plasma membrane of rat renal collecting duct cells: possible role in aquaporin-2 trafficking.
8760387 1996 Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8071310 1994 Functional identification of a vesicular acetylcholine transporter and its expression from a "cholinergic" gene locus.
8011337 1994 A post-docking role for synaptobrevin in synaptic vesicle fusion.
7961655 1994 SNAP-25, a t-SNARE which binds to both syntaxin and synaptobrevin via domains that may form coiled coils.
7835332 1995 Transport route for synaptobrevin via a novel pathway of insertion into the endoplasmic reticulum membrane.
7499863 1995 Subcellular distribution of docking/fusion proteins in neutrophils, secretory cells with multiple exocytic compartments.
1976629 1990 Structures and chromosomal localizations of two human genes encoding synaptobrevins 1 and 2.