Property Summary

NCBI Gene PubMed Count 25
PubMed Score 49.52
PubTator Score 28.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
chronic lymphocytic leukemia 1.830 1.5e-04
malignant mesothelioma -1.600 1.0e-04
astrocytic glioma -1.600 1.4e-02
ependymoma -2.000 1.7e-09
psoriasis -1.500 1.3e-04
glioblastoma -2.100 7.1e-05
oligodendroglioma -1.200 2.7e-07
osteosarcoma -2.882 4.1e-05
group 4 medulloblastoma -3.800 5.7e-07
atypical teratoid / rhabdoid tumor -2.500 6.3e-07
medulloblastoma, large-cell -3.900 1.2e-05
primitive neuroectodermal tumor -1.600 2.0e-03
lung cancer -2.300 2.2e-03
interstitial cystitis 1.700 1.1e-03
adult high grade glioma -2.200 6.3e-04
pilocytic astrocytoma -1.700 2.0e-05
Alzheimer's disease -1.500 2.3e-02
Pick disease -2.500 2.2e-03
ulcerative colitis 1.200 3.0e-03
ovarian cancer 1.100 6.8e-03

Gene RIF (6)

PMID Text
25881291 Genetically regulated VAMP1 expression in the brain may modify both Alzheimer's disease risk and may contribute to Alzheimer's pathophysiology
25010769 residue 48 of VAMP1 varies frequently between M and I across seventeen closely related primate species, suggesting a potential selective pressure from members of BoNTs for resistance in vertebrates.
22958904 This report identifies vesicle-associated membrane protein 1 (VAMP1), which encodes a critical protein for synaptic exocytosis, as the responsible gene fora dominantly inherited spastic ataxia
21330375 multiple domains outside the R-SNARE of tomosyn are critical to the efficacy of inhibition by tomosyn on exocytotic secretion
20877624 Observational study of gene-disease association. (HuGE Navigator)
18457912 The expression of the SNARE protein SNAP-25 and its cellular homologue SNAP-23, as well as syntaxin1 and VAMP (vesicle-associated membrane protein) in samples of normal parathyroid tissue, chief cell adenoma, and parathyroid carcinoma, was examined.

AA Sequence

MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD      1 - 70
ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT                           71 - 118
//

Text Mined References (27)

PMID Year Title
25881291 2015 Genetically-controlled Vesicle-Associated Membrane Protein 1 expression may contribute to Alzheimer's pathophysiology and susceptibility.
25416956 2014 A proteome-scale map of the human interactome network.
25010769 2014 Widespread sequence variations in VAMP1 across vertebrates suggest a potential selective pressure from botulinum neurotoxins.
24534378 2014 Distribution of SNAP25, VAMP1 and VAMP2 in mature and developing deep cerebellar nuclei after estrogen administration.
24152687 2013 Characterization of SNARE proteins in human pituitary adenomas: targeted secretion inhibitors as a new strategy for the treatment of acromegaly?
22958904 2012 VAMP1 mutation causes dominant hereditary spastic ataxia in Newfoundland families.
22289120 2012 Specificity of botulinum protease for human VAMP family proteins.
21330375 2011 Structural and functional analysis of tomosyn identifies domains important in exocytotic regulation.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18457912 2008 Heterogeneous expression of SNARE proteins SNAP-23, SNAP-25, Syntaxin1 and VAMP in human parathyroid tissue.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903296 2007 Genome-wide association with bone mass and geometry in the Framingham Heart Study.
16541075 2006 The finished DNA sequence of human chromosome 12.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12093152 2002 Munc 18a binding to syntaxin 1A and 1B isoforms defines its localization at the plasma membrane and blocks SNARE assembly in a three-hybrid system assay.
11391393 2001 Intracellular localization of VAMP-1 protein in human neutrophils.
10544008 1999 VAMP-1 has a highly variable C-terminus generated by alternative splicing.
9920726 1999 Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins.
9658161 1998 A splice-isoform of vesicle-associated membrane protein-1 (VAMP-1) contains a mitochondrial targeting signal.
9657962 1998 Identification of a human homologue of the vesicle-associated membrane protein (VAMP)-associated protein of 33 kDa (VAP-33): a broadly expressed protein that binds to VAMP.
9396746 1997 Export of cellubrevin from the endoplasmic reticulum is controlled by BAP31.
8760387 1996 Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2.
8663154 1996 Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues.
1976629 1990 Structures and chromosomal localizations of two human genes encoding synaptobrevins 1 and 2.