Property Summary

NCBI Gene PubMed Count 26
PubMed Score 52.60
PubTator Score 28.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
ATAXIA, SPASTIC, 1, AUTOSOMAL DOMINANT 1 0.0 0.0
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 1.2
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count
spastic ataxia 1 2

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.200 6.3e-04
Alzheimer's disease -1.500 2.3e-02
astrocytic glioma -1.600 1.4e-02
Astrocytoma, Pilocytic -1.700 2.0e-05
atypical teratoid / rhabdoid tumor -2.500 6.3e-07
Chronic Lymphocytic Leukemia 1.830 1.5e-04
ependymoma -1.500 4.0e-02
glioblastoma -1.800 2.5e-05
group 3 medulloblastoma -1.200 3.8e-02
interstitial cystitis 1.700 1.1e-03
lung cancer -2.300 2.2e-03
malignant mesothelioma -1.200 5.5e-05
medulloblastoma, large-cell -3.900 1.2e-05
oligodendroglioma -1.200 2.7e-07
osteosarcoma -1.197 7.3e-03
ovarian cancer 1.100 6.8e-03
Pick disease -2.100 5.5e-05
primitive neuroectodermal tumor -1.600 2.0e-03
psoriasis -1.500 1.3e-04
ulcerative colitis 1.200 3.0e-03

Gene RIF (7)

AA Sequence

MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRAD      1 - 70
ALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT                           71 - 118
//

Text Mined References (28)

PMID Year Title