Property Summary

NCBI Gene PubMed Count 35
PubMed Score 21.82
PubTator Score 24.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 1.3e-03
Multiple myeloma 1.772 3.9e-05
diabetes mellitus -1.700 1.0e-03
group 3 medulloblastoma 1.400 6.2e-04
ovarian cancer -1.700 1.3e-05

Gene RIF (20)

PMID Text
25974965 we describe the identification of UXT as a novel MDMX-interacting protein
25434787 UXT is a binding protein of PIAS2, and interaction between PIAS2 and UXT may be important for the transcriptional activation of AR.
24743694 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24136450 Knockdown of UXT expression in Treg cells results in a less-suppressive phenotype.
24021647 Data found that the UXT isoforms elicit dual opposing regulatory effects on SARM-induced apoptosis.
23961993 VHL-UXT interaction and VHL-induced ubiquitination of androgen receptor(AR) regulate transcriptional activation of the AR.
22933289 Epstein-Barr virus BGLF4 kinase downregulates NF-kappaB transactivation through phosphorylation of coactivator UXT
22131337 UXT-V1 represents a novel integral component of the MAVS signalosome on mitochondria, mediating the innate antiviral signal transduction.
21907703 these results suggest that Als2 is a binding partner of Uxt and Als2/Uxt interaction could be important for the activation of Nf-kappaB pathway.
21730289 Data show that while Art-27 can bind AR directly, URI is bound to chromatin prior to hormone-dependent recruitment of AR, suggesting a role for URI in modulating AR recruitment to target genes.
21307340 Ubiquitously expressed transcript, UXT-V1, is a novel regulator of TNF-induced apoptosis. It protects cells against TNF-induced apoptosis through modulating complex II formation.
19450687 Is part of an RNA polymerase II-associated complex with possible chaperone activity.
19318562 Loss of ART-27 enhances expression of many androgen-regulated genes, suggesting that ART-27 inhibits gene expression, and nuclear ART-27 expression was lost in the majority of AR-positive recurrent prostate cancers.
17761951 propose a transcriptional regulatory circuit for the developmental expression of ART-27 that includes repression by chromatin modification through a trichostatin A-sensitive factor and activation upon growth factor stimulation via CREB
17635584 UXT suppresses cell transformation and might mediate this function by interaction and inhibition of the biological activity of cell proliferation and survival stimulatory factors like ecotropic viral integration site 1
17620405 UXT is a novel and essential cofactor in the NF-kappa B transcriptional enhanceosome.
17554592 Increasing concentrations of UXT contributes to progressive aggregation of mitochondria.
16221885 UXT is a component of centrosome and is essential for cell viability and may facilitate transformation by corrupting regulated centrosome functions.
14711828 decreased levels of ART-27 protein in prostate cancer tissue may occur as a result of de-differentiation, and indicate that ART-27 is likely to regulate a subset of AR-responsive genes important to prostate growth suppression and differentiation.
11854421 UXT was identified in a screen for proteins that interact with the Androgen Receptor N-terminal activation domain. We termed the protein Androgen Receptor Trapped clone 27 (ART-27). ART-27 appears to function as a transcriptional coactivator protein.

AA Sequence

MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSELYMQ      1 - 70
VDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLE     71 - 140
GLRELQGLQNFPEKPHH                                                         141 - 157
//

Text Mined References (37)

PMID Year Title
25974965 2015 UXT, a novel MDMX-binding protein, promotes glycolysis by mitigating p53-mediated restriction of NF-?B activity.
25434787 2015 Ubiquitously expressed transcript is a novel interacting protein of protein inhibitor of activated signal transducer and activator of transcription 2.
25416956 2014 A proteome-scale map of the human interactome network.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24743694 2014 Art27 interacts with GATA4, FOG2 and NKX2.5 and is a novel co-repressor of cardiac genes.
24136450 2014 UXT is a novel regulatory factor of regulatory T cells associated with Foxp3.
24021647 2013 UXT plays dual opposing roles on SARM-induced apoptosis.
23961993 2013 Regulation of the transcriptional activation of the androgen receptor by the UXT-binding protein VHL.
22933289 2012 Epstein-Barr virus BGLF4 kinase downregulates NF-?B transactivation through phosphorylation of coactivator UXT.
22131337 2012 UXT-V1 facilitates the formation of MAVS antiviral signalosome on mitochondria.
21907703 2011 Alfa-class prefoldin protein UXT is a novel interacting partner of Amyotrophic Lateral Sclerosis 2 (Als2) protein.
21730289 2011 Regulation of androgen receptor-mediated transcription by RPB5 binding protein URI/RMP.
21307340 2011 UXT-V1 protects cells against TNF-induced apoptosis through modulating complex II formation.
21269460 2011 Initial characterization of the human central proteome.
20864032 2010 CK2 phospho-dependent binding of R2TP complex to TEL2 is essential for mTOR and SMG1 stability.
19450687 2009 High-resolution mapping of the protein interaction network for the human transcription machinery and affinity purification of RNA polymerase II-associated complexes.
19318562 2009 Genome-wide impact of androgen receptor trapped clone-27 loss on androgen-regulated transcription in prostate cancer cells.
17761951 2007 Transcriptional regulation of the androgen receptor cofactor androgen receptor trapped clone-27.
17635584 2007 UXT interacts with the transcriptional repressor protein EVI1 and suppresses cell transformation.
17620405 2007 UXT is a novel and essential cofactor in the NF-kappaB transcriptional enhanceosome.
17554592 UXT (Ubiquitously Expressed Transcript) causes mitochondrial aggregation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16221885 2005 UXT is a novel centrosomal protein essential for cell viability.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14711828 2004 ART-27, an androgen receptor coactivator regulated in prostate development and cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615539 2003 Control of nutrient-sensitive transcription programs by the unconventional prefoldin URI.
12762840 Novel complex integrating mitochondria and the microtubular cytoskeleton with chromosome remodeling and tumor suppressor RASSF1 deduced by in silico homology analysis, interaction cloning in yeast, and colocalization in cultured cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944989 2002 An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders.
11854421 2002 Identification and characterization of ART-27, a novel coactivator for the androgen receptor N terminus.
11827465 2002 Sequence analysis of LRPPRC and its SEC1 domain interaction partners suggests roles in cytoskeletal organization, vesicular trafficking, nucleocytosolic shuttling, and chromosome activity.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10087202 1999 Cloning and characterization of UXT, a novel gene in human Xp11, which is widely and abundantly expressed in tumor tissue.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.