Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.77
PubTator Score 8.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (6)

PMID Text
23760561 UVSSA together with USP7 is implicated in regulating transcription-coupled DNA repair.[review]
23631307 Human UVSSA protein is required for the ubiquitination of RNA polymerase and DNA repair after light-induced DNA damage [review].
22902626 KIAA1530 is an important player in TCR but also lead to a better understanding of the molecular mechanism underlying UV(s)S syndrome.
22466612 Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair.
22466611 Mutations in UVSSA cause UV-sensitive syndrome and recruits USP7 to regulate transcription-coupled repair.
22466610 Mutations in the UVSSA gene is associated with UV-sensitive syndrome.

AA Sequence

MDQKLSKLVEELTTSGEPRLNPEKMKELKKICKSSEEQLSRAYRLLIAQLTQEHAEIRLSAFQIVEELFV      1 - 70
RSHQFRMLVVSNFQEFLELTLGTDPAQPLPPPREAAQRLRQATTRAVEGWNEKFGEAYKKLALGYHFLRH     71 - 140
NKKVDFQDTNARSLAERKREEEKQKHLDKIYQERASQAEREMQEMSGEIESCLTEVESCFRLLVPFDFDP    141 - 210
NPETESLGMASGMSDALRSSCAGQVGPCRSGTPDPRDGEQPCCSRDLPASAGHPRAGGGAQPSQTATGDP    211 - 280
SDEDEDSDLEEFVRSHGLGSHKYTLDVELCSEGLKVQENEDNLALIHAARDTLKLIRNKFLPAVCSWIQR    281 - 350
FTRVGTHGGCLKRAIDLKAELELVLRKYKELDIEPEGGERRRTEALGDAEEDEDDEDFVEVPEKEGYEPH    351 - 420
IPDHLRPEYGLEAAPEKDTVVRCLRTRTRMDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALPEPQEAQ    421 - 490
KLAAERARAPVVPYGVDLHYWGQELPTAGKIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHITFAGKF    491 - 560
EPVQHWCRAPRPDGRLCERQDRLKCPFHGKIVPRDDEGRPLDPEDRAREQRRQLQKQERPEWQDPELMRD    561 - 630
VEAATGQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQKKHEKF    631 - 700
SNQFNYALN                                                                 701 - 709
//

Text Mined References (17)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23760561 2013 UVSSA and USP7, a new couple in transcription-coupled DNA repair.
23631307 2013 [Molecular cloning and characterisation of UVSSA, the responsible gene for UV-sensitive syndrome].
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902626 2012 KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR).
22466612 2012 Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair.
22466611 2012 UV-sensitive syndrome protein UVSSA recruits USP7 to regulate transcription-coupled repair.
22466610 2012 Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.