Property Summary

NCBI Gene PubMed Count 49
PubMed Score 45.85
PubTator Score 42.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 8.4e-06
osteosarcoma 7933 3.3e-05
dermatomyositis 966 5.8e-04
Disease Target Count Z-score Confidence
Cancer 2346 3.059 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.867 3.3e-05
tuberculosis and treatment for 6 months 1.200 8.4e-06
dermatomyositis 1.400 5.8e-04

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (24)

PMID Text
26717041 Under-expression of UVRAG is associated with colorectal cancer.
26234763 UVRAG frameshift is expressed as a truncated protein in colorectal cancer with microsatellite instability and promotes tumorigenesis. UVRAG(FS) expression renders cells more sensitive to standard chemotherapy regimen due to a DNA repair defect.
26139536 tubulation requires mTOR activity, and we identified two direct mTOR phosphorylation sites on UVRAG (S550 and S571) that activate VPS34.
25807108 HCV, by differentially inducing the expression of Rubicon and UVRAG, temporally regulated the autophagic flux to enhance its replication.
25533187 Dephosphorylation of UVRAG facilitates the lysosomal degradation of epidermal growth factor receptor (EGFR), reduces EGFR signaling, and suppresses cancer cell proliferation and tumor growth.
24956373 Beclin 1 and UVRAG confer protection against radiation-induced DNA DNA double strand breaks and may maintain centrosome stability in established tumor cells.
24882360 The reports that Grb2, when in excess, interacts with ultraviolet radiation resistance-associated gene protein (UVRAG) under excess conditions of AICD-Grb2 or Grb2.
24550300 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
23200933 Akt1 may inhibit autophagy by decreasing UVRAG expression, which also sensitizes cancer cells to UV irradiation.
22542840 UVRAG promotes DNA double-strand-break repair by directly binding and activating DNA-PK in nonhomologous end joining. Disruption of UVRAG increases genetic instability and sensitivity of cells to irradiation.
22493499 in Escherichia coli-containing phagosomes of mouse macrophages, Slamf1 interacts with the class III PI3K Vps34 in a complex with Beclin-1 and UVRAG
22314358 analysis of how the Beclin1 coiled-coil domain interface regulates homodimer and heterodimer formation with Atg14L and UVRAG
21606679 UVRAG has cytoprotective functions in the cytosol that control the localization of Bax in tumor cells exposed to apoptotic stimuli
21597469 UVRAG has an essential role in the intrinsic mitochondrial pathway of apoptosis by regulating the localization of Bax.
20724836 Data indicate that mechanisms other than autophagy contribute to the tumorigenicity of microsatellite unstable colon carcinomas with monoallelic UVRAG mutation.
20643123 A specific sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates both receptor degradation and cytokinesis, whereas ATG14L, a PI3K-III subunit involved in autophagy, is not required.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20163458 There is an association of UVRAG polymorphisms with susceptibility to non-segmental vitiligo in a Korean sample.
20163458 Observational study of gene-disease association. (HuGE Navigator)
18843052 These results suggest that mammalian cells have at least two distinct class III PI3-kinase complexes, and that beclin 1 interacts distinctly with mammalian Atg14 and UVRAG in two of these complexes.
18641390 Bcl-xL and UVRAG cause a monomer-dimer switch in Beclin1
18552835 Data suggest that a Beclin1-binding autophagic tumour suppressor, UVRAG, interacts with the class C Vps complex, a key component of the endosomal fusion machinery.
18495205 Frameshift mutations in the polyadenine tract in UVRAG gene are present in gastric carcinomas.
17106237 UVRAG: a new player in autophagy and tumor cell growth.

AA Sequence

MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHL      1 - 70
CSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKY     71 - 140
LGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQ    141 - 210
VTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFS    211 - 280
AEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSE    281 - 350
DFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKL    351 - 420
QFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADV    421 - 490
GFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKE    491 - 560
NKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASVQLPGEFHPVSEAELCCTVE    561 - 630
QAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK     631 - 699
//

Text Mined References (60)

PMID Year Title
26717041 2016 miR-183 regulates autophagy and apoptosis in colorectal cancer through targeting of UVRAG.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26234763 2015 Truncating mutation in the autophagy gene UVRAG confers oncogenic properties and chemosensitivity in colorectal cancers.
26139536 2015 mTOR activates the VPS34-UVRAG complex to regulate autolysosomal tubulation and cell survival.
25807108 2015 HCV induces the expression of Rubicon and UVRAG to temporally regulate the maturation of autophagosomes and viral replication.
25533187 2015 mTORC1 phosphorylates UVRAG to negatively regulate autophagosome and endosome maturation.
25490155 2014 Architecture and dynamics of the autophagic phosphatidylinositol 3-kinase complex.
24956373 2014 Beclin 1 and UVRAG confer protection from radiation-induced DNA damage and maintain centrosome stability in colorectal cancer cells.
24882360 2014 Interaction of Grb2 SH3 domain with UVRAG in an Alzheimer's disease-like scenario.
24849286 2014 NRBF2 regulates autophagy and prevents liver injury by modulating Atg14L-linked phosphatidylinositol-3 kinase III activity.
24785657 2014 NRBF2 regulates macroautophagy as a component of Vps34 Complex I.
24554770 2014 The HOPS complex mediates autophagosome-lysosome fusion through interaction with syntaxin 17.
24550300 2014 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056303 2013 PtdIns(3)P-bound UVRAG coordinates Golgi-ER retrograde and Atg9 transport by differential interactions with the ER tether and the beclin 1 complex.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23878393 2013 Role of membrane association and Atg14-dependent phosphorylation in beclin-1-mediated autophagy.
23200933 2013 Protein kinase B/Akt1 inhibits autophagy by down-regulating UVRAG expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22542840 2012 A dual role for UVRAG in maintaining chromosomal stability independent of autophagy.
22493499 2012 Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
22314358 2012 Imperfect interface of Beclin1 coiled-coil domain regulates homodimer and heterodimer formation with Atg14L and UVRAG.
22081109 2011 Inhibition of autophagy by TAB2 and TAB3.
21606679 2011 A critical role for UVRAG in apoptosis.
21597469 2011 UV irradiation resistance-associated gene suppresses apoptosis by interfering with BAX activation.
21118109 2010 The role of ESCRT proteins in fusion events involving lysosomes, endosomes and autophagosomes.
21062745 2011 The RUN domain of rubicon is important for hVps34 binding, lipid kinase inhibition, and autophagy suppression.
20974968 2010 Rubicon controls endosome maturation as a Rab7 effector.
20724836 2010 UVRAG mutations associated with microsatellite unstable colon cancer do not affect autophagy.
20643123 2010 A phosphatidylinositol 3-kinase class III sub-complex containing VPS15, VPS34, Beclin 1, UVRAG and BIF-1 regulates cytokinesis and degradative endocytic traffic.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20163458 2010 Association of UVRAG polymorphisms with susceptibility to non-segmental vitiligo in a Korean sample.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19270696 2009 Two Beclin 1-binding proteins, Atg14L and Rubicon, reciprocally regulate autophagy at different stages.
19050071 2008 Identification of Barkor as a mammalian autophagy-specific factor for Beclin 1 and class III phosphatidylinositol 3-kinase.
18843052 2008 Beclin 1 forms two distinct phosphatidylinositol 3-kinase complexes with mammalian Atg14 and UVRAG.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18641390 2008 Bcl-xL and UVRAG cause a monomer-dimer switch in Beclin1.
18552835 2008 Beclin1-binding UVRAG targets the class C Vps complex to coordinate autophagosome maturation and endocytic trafficking.
18495205 2008 Frameshift mutation of UVRAG, an autophagy-related gene, in gastric carcinomas with microsatellite instability.
17891140 2007 Bif-1 interacts with Beclin 1 through UVRAG and regulates autophagy and tumorigenesis.
17106237 UVRAG: a new player in autophagy and tumor cell growth.
16799551 2006 Autophagic and tumour suppressor activity of a novel Beclin1-binding protein UVRAG.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14737099 2004 Manipulation of nonsense mediated decay identifies gene mutations in colon cancer Cells with microsatellite instability.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12928850 2003 Ascending colon cancer with hepatic metastasis and cholecystolithiasis in a patient with situs inversus totalis without any expression of UVRAG mRNA: report of a case.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10798355 2000 Identification of a gene disrupted by inv(11)(q13.5;q25) in a patient with left-right axis malformation.
9533029 1997 Detailed map of a region commonly amplified at 11q13-->q14 in human breast carcinoma.
9169138 1997 Molecular cloning of a novel human gene encoding a 63-kDa protein and its sublocalization within the 11q13 locus.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2332174 1990 Isolation by polymerase chain reaction of a cDNA whose product partially complements the ultraviolet sensitivity of xeroderma pigmentosum group C cells.