Property Summary

NCBI Gene PubMed Count 18
PubMed Score 30.87
PubTator Score 15.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 5.100 8.0e-10
osteosarcoma -2.155 1.4e-02
non diabetic and post-ischemic heart fai... 1.900 1.5e-02
glioblastoma -1.800 6.4e-05
intraductal papillary-mucinous neoplasm ... -1.200 2.8e-02
pediatric high grade glioma -1.400 1.5e-04

Gene RIF (3)

PMID Text
24798337 UTY(KDM6C) is an active lysine demethylases and catalyzes demethylation of H3K27 peptides.
18976975 Knockdown of ubiquitously transcribed tetratricopeptide repeat gene, Y-linked (UTY) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18511697 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLHEDGARTKTLL      1 - 70
GKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYY     71 - 140
NAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDYKSSLKHFQLALIDCNPCTLSNAEIQFHIAH    141 - 210
LYETQRKYHSAKEAYEQLLQTENLPAQVKATVLQQLGWMHHNMDLVGDKATKESYAIQYLQKSLEADPNS    211 - 280
GQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAA    281 - 350
AWMDLGTLYESCNQPQDAIKCYLNAARSKRCSNTSTLAARIKFLQNGSDNWNGGQSLSHHPVQQVYSLCL    351 - 420
TPQKLQHLEQLRANRDNLNPAQKHQLEQLESQFVLMQQMRHKEVAQVRTTGIHNGAITDSSLPTNSVSNR    421 - 490
QPHGALTRVSSVSQPGVRPACVEKLLSSGAFSAGCIPCGTSKILGSTDTILLGSNCIAGSESNGNVPYLQ    491 - 560
QNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCLSGPNEEQPLFSTGSAQYHQATSTGIKKANE    561 - 630
HLTLPSNSVPQGDADSHLSCHTATSGGQQGIMFTKESKPSKNRSLVPETSRHTGDTSNGCADVKGLSNHV    631 - 700
HQLIADAVSSPNHGDSPNLLIADNPQLSALLIGKANGNVGTGTCDKVNNIHPAVHTKTDHSVASSPSSAI    701 - 770
STATPSPKSTEQRSINSVTSLNSPHSGLHTVNGEGLGKSQSSTKVDLPLASHRSTSQILPSMSVSICPSS    771 - 840
TEVLKACRNPGKNGLSNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNP    841 - 910
KNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWRCESNRSHTTIA    911 - 980
KYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGRRRKGPFKTIKFGTNIDLSDNKKWKLQLHEL    981 - 1050
TKLPAFARVVSAGNLLTHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEDY   1051 - 1120
WGVLNDFCEKNNLNFLMSSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGP   1121 - 1190
LTACQYKLAVERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAA   1191 - 1260
GKEVIWHGRTNDEPAHYCSICEVEVFNLLFVTNESNTQKTYIVHCHDCARKTSKSLENFVVLEQYKMEDL   1261 - 1330
IQVYDQFTLALSLSSSS                                                        1331 - 1347
//

Text Mined References (19)

PMID Year Title
24798337 2014 Human UTY(KDM6C) is a male-specific N?-methyl lysyl demethylase.
21329462 2011 Huge splicing frequency in human Y chromosomal UTY gene.
18511697 2008 Genetic variants of Y chromosome are associated with a protective lipid profile in black men.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
15758204 2005 Positive and negative selection on mammalian Y chromosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660691 2004 Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches.
12815422 2003 The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11049993 2000 UTY gene codes for an HLA-B60-restricted human male-specific minor histocompatibility antigen involved in stem cell graft rejection: characterization of the critical polymorphic amino acid residues for T-cell recognition.
10861003 2000 Population genetic implications from sequence variation in four Y chromosome genes.
10767340 2000 Deletion and expression analysis of AZFa genes on the human Y chromosome revealed a major role for DBY in male infertility.
10679124 2000 The human UTY gene encodes a novel HLA-B8-restricted H-Y antigen.
9854018 1999 Groucho/transducin-like enhancer of split (TLE) family members interact with the yeast transcriptional co-repressor SSN6 and mammalian SSN6-related proteins: implications for evolutionary conservation of transcription repression mechanisms.
9499428 1998 The UTX gene escapes X inactivation in mice and humans.
9381176 1997 Functional coherence of the human Y chromosome.
8944031 1996 An H-YDb epitope is encoded by a novel mouse Y chromosome gene.